FKBP11 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84678

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: EAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGHKQVIPG

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for FKBP11 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: FKBP11 Antibody [NBP1-84678]

Immunocytochemistry/ Immunofluorescence: FKBP11 Antibody [NBP1-84678]

Immunocytochemistry/Immunofluorescence: FKBP11 Antibody [NBP1-84678] - Staining of human cell line A-431 shows localization to centrosome. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: FKBP11 Antibody [NBP1-84678]

Immunohistochemistry-Paraffin: FKBP11 Antibody [NBP1-84678]

Immunohistochemistry-Paraffin: FKBP11 Antibody [NBP1-84678] - Staining of human pancreas shows high expression.
FKBP11 Antibody - BSA Free Immunohistochemistry-Paraffin: FKBP11 Antibody - BSA Free [NBP1-84678]

Immunohistochemistry-Paraffin: FKBP11 Antibody - BSA Free [NBP1-84678]

Staining of human skeletal muscle shows no positivity in myocytes as expected.
FKBP11 Antibody - BSA Free Western Blot: FKBP11 Antibody - BSA Free [NBP1-84678]

Western Blot: FKBP11 Antibody - BSA Free [NBP1-84678]

Analysis in human cell line Daudi.
FKBP11 Antibody - BSA Free Immunohistochemistry-Paraffin: FKBP11 Antibody - BSA Free [NBP1-84678]

Immunohistochemistry-Paraffin: FKBP11 Antibody - BSA Free [NBP1-84678]

Analysis in human pancreas and skeletal muscle tissues using HPA041709 antibody. Corresponding FKBP11 RNA-seq data are presented for the same tissues.
FKBP11 Antibody - BSA Free Immunohistochemistry-Paraffin: FKBP11 Antibody - BSA Free [NBP1-84678]

Immunohistochemistry-Paraffin: FKBP11 Antibody - BSA Free [NBP1-84678]

Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.
FKBP11 Antibody - BSA Free Immunohistochemistry-Paraffin: FKBP11 Antibody - BSA Free [NBP1-84678]

Immunohistochemistry-Paraffin: FKBP11 Antibody - BSA Free [NBP1-84678]

Staining of human duodenum shows strong cytoplasmic positivity in lymphoid cells.
FKBP11 Antibody - BSA Free Western Blot: FKBP11 Antibody - BSA Free [NBP1-84678]

Western Blot: FKBP11 Antibody - BSA Free [NBP1-84678]

Analysis in mouse liver tissue and rat liver tissue.

Applications for FKBP11 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FKBP11

Alternate Names

19 kDa FK506-binding protein, EC 5.2.1.8, FK506 binding protein 11, 19 kDa, FK506-binding protein 11, FKBP-11, FKBP-19, FKBP19FK506 binding protein 11 (19 kDa), MGC54182,19 kDa FKBP, peptidyl-prolyl cis-trans isomerase FKBP11, PPIase FKBP11, rotamase

Gene Symbol

FKBP11

Additional FKBP11 Products

Product Documents for FKBP11 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FKBP11 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FKBP11 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FKBP11 Antibody - BSA Free and earn rewards!

Have you used FKBP11 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...