G protein alpha-13 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-87477
Loading...
Key Product Details
Species Reactivity
Human, Mouse
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human G protein alpha-13. Peptide sequence: GCLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESGKSTFLK The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Scientific Data Images for G protein alpha-13 Antibody - BSA Free
Western Blot: G protein alpha-13 Antibody [NBP2-87477]
Western Blot: G protein alpha-13 Antibody [NBP2-87477] - WB Suggested Anti-GNA13 Antibody. Titration: 1.0 ug/ml. Positive Control: COLO205 Whole CellWestern Blot: G protein alpha-13 Antibody [NBP2-87477]
Western Blot: G protein alpha-13 Antibody [NBP2-87477] - Host: Mouse. Target Name: GNA13. Sample Tissue: Mouse Skeletal Muscle. Antibody Dilution: 1ug/mlApplications for G protein alpha-13 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: G protein alpha-13
Alternate Names
G alpha-13, G13, G-protein subunit alpha-13, guanine nucleotide binding protein (G protein), alpha 13, guanine nucleotide-binding protein subunit alpha-13, MGC46138
Gene Symbol
GNA13
Additional G protein alpha-13 Products
Product Documents for G protein alpha-13 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for G protein alpha-13 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for G protein alpha-13 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review G protein alpha-13 Antibody - BSA Free and earn rewards!
Have you used G protein alpha-13 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...