GABA-A R pi Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84036

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GABA-A R pi. Peptide sequence: VEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEPVQIALTLDIASISSISE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for GABA-A R pi Antibody - BSA Free

Western Blot: GABA-A R pi Antibody [NBP2-84036]

Western Blot: GABA-A R pi Antibody [NBP2-84036]

Western Blot: GABA-A R pi Antibody [NBP2-84036] - Host: Rabbit. Target: GABRP. Positive control (+): Human esophagus (ES). Negative control (-): Human stomach (ST). Antibody concentration: 1ug/ml
Immunohistochemistry: GABA-A R pi Antibody [NBP2-84036]

Immunohistochemistry: GABA-A R pi Antibody [NBP2-84036]

Immunohistochemistry: GABA-A R pi Antibody [NBP2-84036] - Human Intestine
Western Blot: GABA-A R pi Antibody [NBP2-84036]

Western Blot: GABA-A R pi Antibody [NBP2-84036]

Western Blot: GABA-A R pi Antibody [NBP2-84036] - Host: Rabbit. Target: GABRP. Positive control (+): Human esophagus (ES). Negative control (-): Human stomach (ST). Antibody concentration: 1ug/ml
Western Blot: GABA-A R pi Antibody [NBP2-84036]

Western Blot: GABA-A R pi Antibody [NBP2-84036]

Western Blot: GABA-A R pi Antibody [NBP2-84036] - Host: Rabbit. Target Name: GABRP. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: GABA-A R pi Antibody [NBP2-84036]

Western Blot: GABA-A R pi Antibody [NBP2-84036]

Western Blot: GABA-A R pi Antibody [NBP2-84036] - Host: Rabbit. Target Name: GABRP. Sample Tissue: Human THP-1 Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: GABA-A R pi Antibody [NBP2-84036]

Western Blot: GABA-A R pi Antibody [NBP2-84036]

Western Blot: GABA-A R pi Antibody [NBP2-84036] - Host: Rabbit. Target Name: GABRP. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 1ug/ml

Applications for GABA-A R pi Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GABA-A R pi

The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitorysynaptic transmission in the central nervous system. The subunit encoded by this gene is expressed in severalnon-neuronal tissues including the uterus and ovaries. This subunit can assemble with known GABA A receptor subunits,and the presence of this subunit alters the sensitivity of recombinant receptors to modulatory agents such aspregnanolone. (provided by RefSeq)

Long Name

gamma-Aminobutyric Acid Type A Receptor, pi Polypeptide

Alternate Names

GABAAR pi, GABAARp, GABRP

Gene Symbol

GABRP

Additional GABA-A R pi Products

Product Documents for GABA-A R pi Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GABA-A R pi Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for GABA-A R pi Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GABA-A R pi Antibody - BSA Free and earn rewards!

Have you used GABA-A R pi Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...