Galanin Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-33582
![Immunocytochemistry/ Immunofluorescence: Galanin Antibody [NBP2-33582]](https://resources.rndsystems.com/images/products/Galanin-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33582-img0011.jpg "Immunocytochemistry/ Immunofluorescence: Galanin Antibody [NBP2-33582]")
Scientific images may be resized, cropped, or adjusted for brightness or contrast for presentation purposes. These updates are limited to presentation and do not affect the underlying scientific interpretation of the data. Where available, additional source data may be provided upon request.
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Primate - Macaca mulatta (Rhesus Macaque), Reptile
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence
Cited:
Immunohistochemistry-Frozen
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS
Reactivity Notes
Reactivity in monkey reported in scientific literature (PMID: 2967776).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Galanin Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: Galanin Antibody [NBP2-33582]
Immunocytochemistry/Immunofluorescence: Galanin Antibody [NBP2-33582] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.![Immunohistochemistry-Paraffin: Galanin Antibody [NBP2-33582]](https://resources.rndsystems.com/images/products/Galanin-Antibody-Immunohistochemistry-Paraffin-NBP2-33582-img0015.jpg "Immunohistochemistry-Paraffin: Galanin Antibody [NBP2-33582]")
Immunohistochemistry-Paraffin: Galanin Antibody [NBP2-33582]
Immunohistochemistry-Paraffin: Galanin Antibody [NBP2-33582] - Staining of human rectum shows moderate cytoplasmic positivity in peripheral nerve / ganglion.![Immunohistochemistry-Paraffin: Galanin Antibody [NBP2-33582]](https://resources.rndsystems.com/images/products/Galanin-Antibody-Immunohistochemistry-Paraffin-NBP2-33582-img0012.jpg "Immunohistochemistry-Paraffin: Galanin Antibody [NBP2-33582]")
Immunohistochemistry-Paraffin: Galanin Antibody [NBP2-33582]
Immunohistochemistry-Paraffin: Galanin Antibody [NBP2-33582] - Staining of human liver shows no positivity in hepatocytes as expected.![Immunohistochemistry-Paraffin: Galanin Antibody [NBP2-33582]](https://resources.rndsystems.com/images/products/Galanin-Antibody-Immunohistochemistry-Paraffin-NBP2-33582-img0013.jpg "Immunohistochemistry-Paraffin: Galanin Antibody [NBP2-33582]")
Immunohistochemistry-Paraffin: Galanin Antibody [NBP2-33582]
Immunohistochemistry-Paraffin: Galanin Antibody [NBP2-33582] - Staining of human pituitary gland shows moderate to strong cytoplasmic positivity in endocrine glandular cells.![Immunohistochemistry-Paraffin: Galanin Antibody [NBP2-33582]](https://resources.rndsystems.com/images/products/Galanin-Antibody-Immunohistochemistry-Paraffin-NBP2-33582-img0014.jpg "Immunohistochemistry-Paraffin: Galanin Antibody [NBP2-33582]")
Immunohistochemistry-Paraffin: Galanin Antibody [NBP2-33582]
Immunohistochemistry-Paraffin: Galanin Antibody [NBP2-33582] - Staining of human placenta shows no positivity in trophoblastic cells as expected.Applications for Galanin Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:1000 - 1:2500
Immunohistochemistry-Paraffin
1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Reviewed Applications
Read 1 review rated 4 using NBP2-33582 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Galanin
Additional Galanin Products
Product Documents for Galanin Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Galanin Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for Galanin Antibody - BSA Free
Powered by Bioz
Customer Reviews for Galanin Antibody - BSA Free (1)
4 out of 5
1 Customer Rating
Have you used Galanin Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Customer Images
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: Immunohistochemistry-ParaffinSample Tested: rhesus monkey gingival epitheliumSpecies: Macaca mulattaVerified Customer | Posted 02/13/2017Rhesus monkey (Macaca mulatta) gingival sections stained with anti-galanin antibody (NBP2-33582).HIER = Diva Decloaker (pressure cooker) Antibody Dilution = 1:1000 Incubation = 4°C overnight Chromogen = DAB Reference code NSCS16
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...