Gamma Adaptin Antibody (4U2C8)

Novus Biologicals | Catalog # NBP3-15727

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 4U2C8 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 723-822 of human Gamma Adaptin (O43747). RSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSIVPAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

91 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Gamma Adaptin Antibody (4U2C8)

Western Blot: Gamma Adaptin Antibody (4U2C8) [NBP3-15727]

Western Blot: Gamma Adaptin Antibody (4U2C8) [NBP3-15727]

Western Blot: Gamma Adaptin Antibody (4U2C8) [NBP3-15727] - Analysis of extracts of various cell lines, using Gamma Adaptin antibody (NBP3-15727) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Immunohistochemistry-Paraffin: Gamma Adaptin Antibody (4U2C8) [NBP3-15727]

Immunohistochemistry-Paraffin: Gamma Adaptin Antibody (4U2C8) [NBP3-15727]

Immunohistochemistry-Paraffin: Gamma Adaptin Antibody (4U2C8) [NBP3-15727] - Human esophageal cancer using Gamma Adaptin Rabbit mAb (NBP3-15727) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Gamma Adaptin Antibody (4U2C8) [NBP3-15727]

Immunohistochemistry-Paraffin: Gamma Adaptin Antibody (4U2C8) [NBP3-15727]

Immunohistochemistry-Paraffin: Gamma Adaptin Antibody (4U2C8) [NBP3-15727] - Rat ovary using Gamma Adaptin Rabbit mAb (NBP3-15727) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Applications for Gamma Adaptin Antibody (4U2C8)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Immunohistochemistry

1:100 - 1:500

Immunohistochemistry-Paraffin

1:100 - 1:500

Western Blot

1:1000 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Gamma Adaptin

Adaptins are important components of clathrin-coated vesicles transporting ligand-receptor complexes from the plasma membrane or from the trans-Golgi network to lysosomes. The adaptin family of proteins is composed of four classes of molecules named alpha, beta, beta prime and gamma adaptins. Adaptins, together with medium and small subunits, form a heterotetrameric complex called an adaptor, whose role is to promote the formation of clathrin-coated pits and vesicles. The protein encoded by this gene is a gamma-adaptin protein and it belongs to the adaptor complexes large subunits family.

Alternate Names

Adapter-related protein complex 1 subunit gamma-1, Adaptor protein complex AP-1 subunit gamma-1, adaptor-related protein complex 1, gamma 1 subunit, ADTGclathrin assembly protein complex 1 gamma large chain, AP-1 complex subunit gamma-1, CLAPG1clathrin-associated/assembly/adaptor protein, large, gamma 1, Clathrin assembly protein complex 1 gamma-1 large chain, gamma adaptin, gamma1-adaptin, golgi adaptor HA1/AP1 adaptin gamma subunit, Golgi adaptor HA1/AP1 adaptin subunit gamma-1, MGC18255

Gene Symbol

AP1G1

Additional Gamma Adaptin Products

Product Documents for Gamma Adaptin Antibody (4U2C8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Gamma Adaptin Antibody (4U2C8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Gamma Adaptin Antibody (4U2C8)

Customer Reviews for Gamma Adaptin Antibody (4U2C8)

There are currently no reviews for this product. Be the first to review Gamma Adaptin Antibody (4U2C8) and earn rewards!

Have you used Gamma Adaptin Antibody (4U2C8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...