GAT3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91920

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GTLPEKLQKLTTPSTDLKMRGKLGVSPRMVTVNDCDAKLKSDGTIAAITEKETHF

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (87%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GAT3 Antibody - BSA Free

Western Blot: GAT3 Antibody [NBP1-91920]

Western Blot: GAT3 Antibody [NBP1-91920]

Western Blot: GAT3 Antibody [NBP1-91920] - Analysis in human cerebral cortex tissue.
GAT3 Antibody - BSA Free Immunohistochemistry: GAT3 Antibody - BSA Free [NBP1-91920]

Immunohistochemistry: GAT3 Antibody - BSA Free [NBP1-91920]

Staining of human Liver shows no positivity in hepatocytes as expected.
GAT3 Antibody - BSA Free Western Blot: GAT3 Antibody - BSA Free [NBP1-91920]

Western Blot: GAT3 Antibody - BSA Free [NBP1-91920]

Analysis in human cerebral cortex tissue.
GAT3 Antibody - BSA Free

Western Blot: GAT3 Antibody - BSA Free [NBP1-91920] -

Glutamate and GABA transporter levels in the synaptosomal fraction. (A) Representative western blots of glutamate and GABA transporter protein expression in wild-type, wild-type/dnSNARE, BACHD and BACHD/dnSNARE mice. (B) Western blot quantification of the transporters (shown are n=3 independent samples). HTT was probed to confirm the genotype of sample mice on the same blot probed for GAT1 (same beta -actin loading control as shown for GAT1). No significant difference was observed in GLT1, GAT3 and GAT1 (n=5-6/genotype). Data are mean+/-s.e.m. Differences among the groups were assessed by one-way ANOVA followed by Tukey's HSD multiple comparison procedure. Non-significant P-values are not displayed on graphs. Refer to Table 1 for all P-values. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/39526491), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
GAT3 Antibody - BSA Free

Western Blot: GAT3 Antibody - BSA Free [NBP1-91920] -

Expression of neurotransmitter transporters. (A,B) Representative RNAscope images of Slc6a1, Slc6a11and Gja1 in the striatum. Scale bars: 50 μm. The numbers of Gja1-positive cells co-labeled with Slc6a1 (encoding GAT1) or Slc6a11 (encoding GAT3) were counted. (C) Representative western blots of GLT1, GAT3 and GAT1 protein expression in the striatum of wild-type, wild-type/dnSNARE, BACHD and BACHD/dnSNARE mice (each lane represents a single sample; each sample is pooled from three mice of the same genotype). (D) Western blot quantification of GLT1, GAT3 and GAT1 (n=6/genotype). WT, wild type. The loading control beta -actin shown for GAT1 in C is the same as the beta -actin shown for Cx43 in Fig. 5A. The same membrane was probed for beta -actin, GAT1 and Cx43. The loading control beta -actin shown for GLT1 in C is the same as the beta -actin used for GFAP in Fig. 5A. GLT1 and GFAP were probed on the same blot membrane. Data are mean+/-s.e.m. Differences among the groups were assessed by one-way ANOVA followed by Tukey's HSD multiple comparison procedure. Non-significant P-values are not displayed on graphs. Refer to Table 1 for all P-values. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/39526491), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for GAT3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GAT3

Gamma-aminobutyric acid (GABA) is the primary inhibitory neurotransmitter in the central nervous system, causing a hyperpolarization of the membrane through the opening of a Cl negative channel associated with the GABAA receptor (GABAA-R) subtype. GABA plasma membrane transporters (GATs) influence synaptic neurotransmission by high-affinity uptake and release of GABA. To date, four distinct GABA transporters have been identified: GAT-1, GAT-2, GAT-3, and BGT-1. GAT-3 has been found to be localized to astrocytes within the cerebral cortex indicating that this transporter mediates GABA uptake into glial cells (Minelli et al., 1996).

Long Name

Sodium- and chloride-dependent GABA transporter 3

Alternate Names

GABT3, GAT-3, SLC6A11

Gene Symbol

SLC6A11

Additional GAT3 Products

Product Documents for GAT3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GAT3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for GAT3 Antibody - BSA Free

Customer Reviews for GAT3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GAT3 Antibody - BSA Free and earn rewards!

Have you used GAT3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...