Glutathione Synthetase Antibody - Azide and BSA Free
Novus Biologicals | Catalog # NBP3-03702
Loading...
Key Product Details
Validated by
Knockout/Knockdown
Species Reactivity
Human, Mouse, Rat
Applications
Knockout Validated, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 373-474 of human Glutathione Synthetase (NP_000169.1). NLYGEEMVQALKQLKDSEERASYILMEKIEPEPFENCLLRPGSPARVVQCISELGIFGVYVRQEKTLVMNKHVGHLLRTKAIEHADGGVAAGVAVLDNPYPV
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Glutathione Synthetase Antibody - Azide and BSA Free
Western Blot: Glutathione Synthetase AntibodyAzide and BSA Free [NBP3-03702]
Western Blot: Glutathione Synthetase Antibody [NBP3-03702] - WB image submitted by a verified customer review.Western Blot: Glutathione Synthetase Antibody - Azide and BSA Free [NBP3-03702]
Western Blot: Glutathione Synthetase Antibody [NBP3-03702] - Analysis of extracts from normal (control) and GSS knockout (KO) 293T cells, using Glutathione Synthetase antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Immunocytochemistry/ Immunofluorescence: Glutathione Synthetase Antibody - Azide and BSA Free [NBP3-03702] -
Immunocytochemistry/ Immunofluorescence: Glutathione Synthetase Antibody - Azide and BSA Free [NBP3-03702] - Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] Glutathione Synthetase Rabbit pAb (A14535) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.Immunocytochemistry/ Immunofluorescence: Glutathione Synthetase Antibody - Azide and BSA Free [NBP3-03702] -
Immunocytochemistry/ Immunofluorescence: Glutathione Synthetase Antibody - Azide and BSA Free [NBP3-03702] - Immunofluorescence analysis of U2OS cells using [KO Validated] Glutathione Synthetase Rabbit pAb (A14535) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.Immunocytochemistry/ Immunofluorescence: Glutathione Synthetase Antibody - Azide and BSA Free [NBP3-03702] -
Immunocytochemistry/ Immunofluorescence: Glutathione Synthetase Antibody - Azide and BSA Free [NBP3-03702] - Immunofluorescence analysis of PC-12 cells using [KO Validated] Glutathione Synthetase Rabbit pAb (A14535) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.Applications for Glutathione Synthetase Antibody - Azide and BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Western Blot
1:500 - 1:2000
Reviewed Applications
Read 1 review rated 5 using NBP3-03702 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
Azide and BSA Free
Preservative
0.01% Thimerosal
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Glutathione Synthetase
Alternate Names
EC 6.3.2.3, Glutathione synthase, glutathione synthetase, GSH synthetase, GSHS, GSH-S, MGC14098
Gene Symbol
GSS
Additional Glutathione Synthetase Products
Product Documents for Glutathione Synthetase Antibody - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Glutathione Synthetase Antibody - Azide and BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.govCitations for Glutathione Synthetase Antibody - Azide and BSA Free
Customer Reviews for Glutathione Synthetase Antibody - Azide and BSA Free (1)
5 out of 5
1 Customer Rating
Have you used Glutathione Synthetase Antibody - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Customer Images
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: Western BlotSample Tested: mouse liver, Mouse brain and Mouse kidneySpecies: MouseVerified Customer | Posted 08/16/2021GSS-Review-2021
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...