Glutathione Synthetase Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-03702

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Knockout Validated, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 373-474 of human Glutathione Synthetase (NP_000169.1). NLYGEEMVQALKQLKDSEERASYILMEKIEPEPFENCLLRPGSPARVVQCISELGIFGVYVRQEKTLVMNKHVGHLLRTKAIEHADGGVAAGVAVLDNPYPV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Glutathione Synthetase Antibody - Azide and BSA Free

Western Blot: Glutathione Synthetase AntibodyAzide and BSA Free [NBP3-03702]

Western Blot: Glutathione Synthetase AntibodyAzide and BSA Free [NBP3-03702]

Western Blot: Glutathione Synthetase Antibody [NBP3-03702] - WB image submitted by a verified customer review.
Knockout Validated: Glutathione Synthetase Antibody - Azide and BSA Free [NBP3-03702]

Western Blot: Glutathione Synthetase Antibody - Azide and BSA Free [NBP3-03702]

Western Blot: Glutathione Synthetase Antibody [NBP3-03702] - Analysis of extracts from normal (control) and GSS knockout (KO) 293T cells, using Glutathione Synthetase antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.
Glutathione Synthetase Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Glutathione Synthetase Antibody - Azide and BSA Free [NBP3-03702] -

Immunocytochemistry/ Immunofluorescence: Glutathione Synthetase Antibody - Azide and BSA Free [NBP3-03702] - Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] Glutathione Synthetase Rabbit pAb (A14535) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Glutathione Synthetase Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Glutathione Synthetase Antibody - Azide and BSA Free [NBP3-03702] -

Immunocytochemistry/ Immunofluorescence: Glutathione Synthetase Antibody - Azide and BSA Free [NBP3-03702] - Immunofluorescence analysis of U2OS cells using [KO Validated] Glutathione Synthetase Rabbit pAb (A14535) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Glutathione Synthetase Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Glutathione Synthetase Antibody - Azide and BSA Free [NBP3-03702] -

Immunocytochemistry/ Immunofluorescence: Glutathione Synthetase Antibody - Azide and BSA Free [NBP3-03702] - Immunofluorescence analysis of PC-12 cells using [KO Validated] Glutathione Synthetase Rabbit pAb (A14535) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Glutathione Synthetase Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Reviewed Applications

Read 1 review rated 5 using NBP3-03702 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Glutathione Synthetase

Glutathione is important for a variety of biological functions, including protection of cells from oxidative damage byfree radicals, detoxification of xenobiotics, and membrane transport. The protein encoded by this gene functions as ahomodimer to catalyze the second step of glutathione biosynthesis, which is the ATP-dependent conversion ofgamma-L-glutamyl-L-cysteine to glutathione. Defects in this gene are a cause of glutathione synthetase deficiency.(provided by RefSeq)

Alternate Names

EC 6.3.2.3, Glutathione synthase, glutathione synthetase, GSH synthetase, GSHS, GSH-S, MGC14098

Gene Symbol

GSS

Additional Glutathione Synthetase Products

Product Documents for Glutathione Synthetase Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Glutathione Synthetase Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Citations for Glutathione Synthetase Antibody - Azide and BSA Free

Customer Reviews for Glutathione Synthetase Antibody - Azide and BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Glutathione Synthetase Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 1 of 1 review Showing All
Filter By:
  • Glutathione Synthetase Antibody
    Name: Hua Jiang
    Application: Western Blot
    Sample Tested: mouse liver, Mouse brain and Mouse kidney
    Species: Mouse
    Verified Customer | Posted 08/16/2021
    GSS-Review-2021
    Glutathione Synthetase Antibody - Azide and BSA Free NBP3-03702

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...