Glycogen Phosphorylase BB/GPBB Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54966

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to PYGB(phosphorylase, glycogen; brain) The peptide sequence was selected from the N terminal of PYGB. Peptide sequence ADDWLRYGNPWEKARPEYMLPVHFYGRVEHTPDGVKWLDTQVVLAMPYDT. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

97 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Glycogen Phosphorylase BB/GPBB Antibody - BSA Free

Western Blot: Glycogen Phosphorylase BB/GPBB Antibody [NBP1-54966]

Western Blot: Glycogen Phosphorylase BB/GPBB Antibody [NBP1-54966]

Western Blot: GPBB Antibody [NBP1-54966] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.

Applications for Glycogen Phosphorylase BB/GPBB Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Glycogen Phosphorylase BB/GPBB

PYGB is a glycogen phosphorylase found predominantly in the brain. It forms homodimers which can associate into homotetramers, the enzymatically active form of glycogen phosphorylase. The activity of this enzyme is positively regulated by AMP and negatively regulated by ATP, ADP, and glucose-6-phosphate. This enzyme catalyzes the rate-determining step in glycogen degradation. The protein encoded by this gene is a glycogen phosphorylase found predominantly in the brain. The encoded protein forms homodimers which can associate into homotetramers, the enzymatically active form of glycogen phosphorylase. The activity of this enzyme is positively regulated by AMP and negatively regulated by ATP, ADP, and glucose-6-phosphate. This enzyme catalyzes the rate-determining step in glycogen degradation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

PYGB

Gene Symbol

PYGB

UniProt

Additional Glycogen Phosphorylase BB/GPBB Products

Product Documents for Glycogen Phosphorylase BB/GPBB Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Glycogen Phosphorylase BB/GPBB Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Glycogen Phosphorylase BB/GPBB Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Glycogen Phosphorylase BB/GPBB Antibody - BSA Free and earn rewards!

Have you used Glycogen Phosphorylase BB/GPBB Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...