GNA11 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-98606

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen for this antibody is GNA11 - C-terminal region. Peptide sequence PFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVES. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for GNA11 Antibody - BSA Free

Western Blot: GNA11 Antibody [NBP1-98606]

Western Blot: GNA11 Antibody [NBP1-98606]

Western Blot: GNA11 Antibody [NBP1-98606] - Mouse kidney lysate. Antibody at 1 ug/mL.
Western Blot: GNA11 Antibody [NBP1-98606]

Western Blot: GNA11 Antibody [NBP1-98606]

Western Blot: GNA11 Antibody [NBP1-98606] - Human Fetal Brain Lysate. Antibody at 1 ug/mL.
Western Blot: GNA11 Antibody [NBP1-98606]

Western Blot: GNA11 Antibody [NBP1-98606]

Western Blot: GNA11 Antibody [NBP1-98606] - Analysis of 293T cell lysate. Antibody at 1 ug/mL.
Western Blot: GNA11 Antibody [NBP1-98606]

Western Blot: GNA11 Antibody [NBP1-98606]

Western Blot: GNA11 Antibody [NBP1-98606] - Analysis of 721_B cell lysate. Antibody at 1 ug/mL.
Western Blot: GNA11 Antibody [NBP1-98606]

Western Blot: GNA11 Antibody [NBP1-98606]

Western Blot: GNA11 Antibody [NBP1-98606] - HeLa cell lysate. Antibody at 1 ug/mL.
Western Blot: GNA11 Antibody [NBP1-98606]

Western Blot: GNA11 Antibody [NBP1-98606]

Western Blot: GNA11 Antibody [NBP1-98606] - Human Adult Placenta cell lysate. Antibody at 1 ug/mL.
Western Blot: GNA11 Antibody [NBP1-98606]

Western Blot: GNA11 Antibody [NBP1-98606]

Western Blot: GNA11 Antibody [NBP1-98606] - Human Fetal Kidney cell lysate. Antibody at 1 ug/mL.
Western Blot: GNA11 Antibody [NBP1-98606]

Western Blot: GNA11 Antibody [NBP1-98606]

Western Blot: GNA11 Antibody [NBP1-98606] - Human Fetal Lung cell lysate. Antibody at 1 ug/mL.

Applications for GNA11 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GNA11

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Acts as an activator of phospholipase C.

Alternate Names

G alpha-11, GA11, GNA-11, G-protein subunit alpha-11, guanine nucleotide binding protein (G protein), alpha 11 (Gq class), Guanine nucleotide-binding protein G(y) subunit alpha, guanine nucleotide-binding protein subunit alpha-11, guanine nucleotide-binding protein, Gq class, GNA11

Gene Symbol

GNA11

Additional GNA11 Products

Product Documents for GNA11 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GNA11 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GNA11 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GNA11 Antibody - BSA Free and earn rewards!

Have you used GNA11 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...