GRHL3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80018

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Chromatin Immunoprecipitation (ChIP)

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the C terminal of human GRHL3. Peptide sequence SGVKGCLLSGFRGNETTYLRPETDLETPPVLFIPNVHFSSLQRSGGAAPS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for GRHL3 Antibody - BSA Free

Western Blot: GRHL3 Antibody [NBP1-80018]

Western Blot: GRHL3 Antibody [NBP1-80018]

Western Blot: GRHL3 Antibody [NBP1-80018] - Host: Rabbit. Target Name: GRHL3. Sample Tissue: Human 786-0 Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: GRHL3 Antibody [NBP1-80018]

Western Blot: GRHL3 Antibody [NBP1-80018]

Western Blot: GRHL3 Antibody [NBP1-80018] - Human Placenta lysate, concentration 0.2-1 ug/ml.

Applications for GRHL3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GRHL3

The protein encoded by the GRHL3 gene is part of the grainyhead family of transcription factors and exists in 5 isoforms: isoform 1: 626 AA long, 70 kDA; isoform 2: 607 AA long, 68 kDA; isoform 3: 555 AA long, 62 kDA; isoform 4: 509 AA long; 57 kDA; isoform 5: 602 AA long, 67 kDA. The coded protein works as a transcription factor during development and initiates migration of endothelial cells. GRHL3 frequently interacts with genes GRHL1 and GRHL2. It has been associated with diseases spina bifida, tonsillitis, and prostatitis.

Alternate Names

grainyhead-like 3 (Drosophila), MGC46624, Sister of mammalian grainyhead, sister-of-mammalian grainyhead, SOMTranscription factor CP2-like 4grainyhead-like protein 3 homolog, TFCP2L4, transcription factor hSOM1

Gene Symbol

GRHL3

Additional GRHL3 Products

Product Documents for GRHL3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GRHL3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GRHL3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GRHL3 Antibody - BSA Free and earn rewards!

Have you used GRHL3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...