H1FX Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-31980

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: ALPVTTAEGMAKKVTKAGGSAALSPSKKRKNSKKKNQPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for H1FX Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: H1FX Antibody [NBP2-31980]

Immunocytochemistry/ Immunofluorescence: H1FX Antibody [NBP2-31980]

Immunocytochemistry/Immunofluorescence: H1FX Antibody [NBP2-31980] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli. Antibody staining is shown in green.
H1FX Antibody - BSA Free Chromatin Immunoprecipitation ChIP: H1FX Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: H1FX Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-H1FX tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.
H1FX Antibody - BSA Free Immunohistochemistry-Paraffin: H1FX Antibody [NBP2-31980]

Immunohistochemistry-Paraffin: H1FX Antibody [NBP2-31980]

Staining of human colon shows moderate nuclear positivity in glandular cells.

Applications for H1FX Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: H1FX

Histones are nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber as they play a critical role in transcription regulation, DNA repair, DNA replication, and chromosomal stability. The H1FX gene encodes a H1 Histone family, member X protein that is 213 amino acids long at 22 kDA. H1 Histones are critical for condensation of nucleosome chains into higher-order structures. H1FX participates in PKA signaling, Granzyme-A pathway, histone modification, and cell cycle start of DNA replication in early S phase. H1FX is known to interact with XBP1, TOP1, RRP1B, NPM1, and DOT1L. The H1FX gene was associated with treacher collins syndrome and metastasis efficiency.

Alternate Names

H1 histone family, member X, H1X, histone H1x, MGC15959, MGC8350

Gene Symbol

H1-10

UniProt

Additional H1FX Products

Product Documents for H1FX Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for H1FX Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for H1FX Antibody - BSA Free

There are currently no reviews for this product. Be the first to review H1FX Antibody - BSA Free and earn rewards!

Have you used H1FX Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...