H4 Clustered Histone 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35713

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human H4 Clustered Histone 1 (NP_003529.1).

Sequence:
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

11 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for H4 Clustered Histone 1 Antibody - BSA Free

H4 Clustered Histone 1 Antibody

Western Blot: H4 Clustered Histone 1 Antibody [NBP3-35713] -

Western Blot: H4 Clustered Histone 1 Antibody [NBP3-35713] - Western blot analysis of various lysates using H4 Clustered Histone 1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates / proteins: 25 ug per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
H4 Clustered Histone 1 Antibody

Immunocytochemistry/ Immunofluorescence: H4 Clustered Histone 1 Antibody [NBP3-35713] -

Immunocytochemistry/ Immunofluorescence: H4 Clustered Histone 1 Antibody [NBP3-35713] - Immunofluorescence analysis of HeLa cells using H4 Clustered Histone 1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
H4 Clustered Histone 1 Antibody

Immunocytochemistry/ Immunofluorescence: H4 Clustered Histone 1 Antibody [NBP3-35713] -

Immunocytochemistry/ Immunofluorescence: H4 Clustered Histone 1 Antibody [NBP3-35713] - Immunofluorescence analysis of C6 cells using H4 Clustered Histone 1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
H4 Clustered Histone 1 Antibody

Western Blot: H4 Clustered Histone 1 Antibody [NBP3-35713] -

Western Blot: H4 Clustered Histone 1 Antibody [NBP3-35713] - Western Blot analysis of various lysates using H4 Clustered Histone 1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates / proteins: 25 ug per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.

Applications for H4 Clustered Histone 1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: H4 Clustered Histone 1

Alternate Names

H4-16;H4C11;H4C12;H4C13;H4C14;H4C15;H4C2;H4C3;H4C4;H4C5;H4C6;H4C8;H4C9;H4FA, H4F4, HIST1H4A

Gene Symbol

H4C1

Additional H4 Clustered Histone 1 Products

Product Documents for H4 Clustered Histone 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for H4 Clustered Histone 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for H4 Clustered Histone 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review H4 Clustered Histone 1 Antibody - BSA Free and earn rewards!

Have you used H4 Clustered Histone 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...