HA95/AKAP8L Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-47440

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Cited:

Human

Predicted:

Mouse (92%), Rat (93%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: DEEGKEDGREEGKEDPEKGALTTQDENGQTKRKLQAGKKSQDKQKKRQRDRMVERIQFVCSLCKYRTFYEDEMASHLDSKFHKEHFKYVGTKLPKQTAD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HA95/AKAP8L Antibody - BSA Free

Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47440]

Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47440]

Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47440] - Staining in human testis and liver tissues using anti-AKAP8L antibody. Corresponding AKAP8L RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47440]

Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47440]

Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47440] - Staining of human cerebral cortex, colon, kidney and testis using Anti-AKAP8L antibody NBP2-47440 (A) shows similar protein distribution across tissues to independent antibody NBP2-47441 (B).
Western Blot: HA95/AKAP8L Antibody [NBP2-47440]

Western Blot: HA95/AKAP8L Antibody [NBP2-47440]

Western Blot: HA95/AKAP8L Antibody [NBP2-47440] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: HA95/AKAP8L Antibody [NBP2-47440]

Immunocytochemistry/ Immunofluorescence: HA95/AKAP8L Antibody [NBP2-47440]

Immunocytochemistry/Immunofluorescence: HA95/AKAP8L Antibody [NBP2-47440] - Immunofluorescent staining of human cell line MCF7 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47440]

Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47440]

Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47440] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47440]

Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47440]

Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47440] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47440]

Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47440]

Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47440] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47440]

Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47440]

Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47440] - Staining of human colon.
Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47440]

Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47440]

Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47440] - Staining of human kidney.
HA95/AKAP8L Antibody - BSA Free

Western Blot: HA95/AKAP8L Antibody - BSA Free [NBP2-47440] -

SCD1 mediates the effects of AKAP8L on GC cell stemness and chemoresistance.SCD1 siRNA was transiently transfected to AKAP8L overexpressing cells. SCD1 inhibitor (CAY10566) was added into AKAP8L overexpressing cells. A Representative images of spheroids in the SCD1 inhibitor, AKAP8L, AKAP8L/SCD1 inhibitor and the control groups. B, C qPCR and Western blot assays showed the stemness-related gene expression induced by AKAP8L/CAY10566 or AKAP8L/si-SCD1. D Cell viability was measured by MTT in four groups after the treatments of Oxa. E Representative images of flow cytometry showed the percentage of apoptotic cells in four groups after the treatments of Oxa. F Western blot analysis of cleaved-caspase 3 and cleaved-PAPR induced by AKAP8L/CAY10566 or AKAP8L/si-SCD1. Scale bar indicates 50 μm. The values indicate the mean +/- SD of three independent experiments. *P < 0.05, **P < 0.01, ***P < 0.001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36522343), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
HA95/AKAP8L Antibody - BSA Free

Western Blot: HA95/AKAP8L Antibody - BSA Free [NBP2-47440] -

AKAP8L is upregulated in chemoresistant gastric cancer.A Diagram of the interactions of the top 20 upregulated genes in non-responders to chemotherapy versus responders in a cohort of 6 patients treated at Shandong Cancer Hospital and Institute. B Western blot analysis of AKAP8L in chemosensitive and chemoresistant gastric tumors. Representative images of AKAP8L and CD133 immunostaining in para-carcinoma tissues and gastric tumor tissues (C, D) (tissue array, n = 80). E Two-tailed Spearman’s correlation analysis of AKAP8L and CD133 expression in GC tissues. F, G Analysis of the AKAP8L and CD133 expression levels in relation to the overall survival of GC patients (tissue array, n = 80). H, I Analysis of the AKAP8L expression levels in relation to the overall survival (H) and first progression (I) of GC patients treated with chemotherapy regimen from the Kaplan–Meier plotter database (222160_at) (n = 875). Upper panel: scale bars: 500 μm. Lower panel: scale bars: 20 μm. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36522343), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
HA95/AKAP8L Antibody - BSA Free

Western Blot: HA95/AKAP8L Antibody - BSA Free [NBP2-47440] -

SCD1 mediates the effects of AKAP8L on GC cell stemness and chemoresistance.SCD1 siRNA was transiently transfected to AKAP8L overexpressing cells. SCD1 inhibitor (CAY10566) was added into AKAP8L overexpressing cells. A Representative images of spheroids in the SCD1 inhibitor, AKAP8L, AKAP8L/SCD1 inhibitor and the control groups. B, C qPCR and Western blot assays showed the stemness-related gene expression induced by AKAP8L/CAY10566 or AKAP8L/si-SCD1. D Cell viability was measured by MTT in four groups after the treatments of Oxa. E Representative images of flow cytometry showed the percentage of apoptotic cells in four groups after the treatments of Oxa. F Western blot analysis of cleaved-caspase 3 and cleaved-PAPR induced by AKAP8L/CAY10566 or AKAP8L/si-SCD1. Scale bar indicates 50 μm. The values indicate the mean +/- SD of three independent experiments. *P < 0.05, **P < 0.01, ***P < 0.001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36522343), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
HA95/AKAP8L Antibody - BSA Free

Western Blot: HA95/AKAP8L Antibody - BSA Free [NBP2-47440] -

AKAP8L stabilizes of SCD1 mRNA via IGF2BP1-dependent manner.A m6A RIP and qPCR were used to determine the percentage of SCD1 mRNA with m6A modification in Mettl3 overexpressing cells. Affinity mass spectrometry (B–D) and Co-IP assay (E, F) were performed to detect the interaction of proteins with AKAP8L. G AKAP8L overexpressing cells were transiently transfected IGF2BP1 siRNA. The mRNA level of SCD1 was measured by qPCR. H RIP were used to determine the percentage of SCD1 mRNA with IGF2BP1 in BGC-823/Oxa cells. I BGC-823/Oxa cells were transiently transfected with control or siIGF2BP1 for 48 h and then treated with ActD for 0, 2, 4, 6, 8 h. The SCD1 mRNA level was determined using qPCR. The GAPDH mRNA level was used as a negative control. The values represent the mean +/- SD of three independent experiments (*P < 0.05, **P < 0.01, ***P < 0.001, independent Student’s t-test). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36522343), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
HA95/AKAP8L Antibody - BSA Free

Western Blot: HA95/AKAP8L Antibody - BSA Free [NBP2-47440] -

AKAP8L enhances the stemness in GC cells.A Western blot analysis showed ectopic expression of AKAP8L in GC cells transfected with AKAP8L (AKAP8L) or control lentivirus (Con), and AKAP8L silencing in cells treated with scrambled shRNA (shCon) or shRNA against AKAP8L (shAKAP8L-1, shAKAP8L-2). B Representative images and quantification analysis of spheroids in AKAP8L overexpression or the control groups, and AKAP8L knockdown or the control groups. Scale bar indicates 50 μm. C In soft agar colony formation assay, representative images and numbers of spheroids formed by AKAP8L-overexpressing and AKAP8L-knockdown BGC-823/Oxa and MKN-45/Oxa. Scale bar indicates 50 μm. D, E qPCR and Western blot assays showed the expression of stem cell markers induced by AKAP8L or AKAP8L shRNAs. The values indicate the mean +/- standard deviation (SD) of three independent experiments. *P < 0.05, **P < 0.01,***P < 0.001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36522343), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
HA95/AKAP8L Antibody - BSA Free

Western Blot: HA95/AKAP8L Antibody - BSA Free [NBP2-47440] -

AKAP8L enhances the stemness in GC cells.A Western blot analysis showed ectopic expression of AKAP8L in GC cells transfected with AKAP8L (AKAP8L) or control lentivirus (Con), and AKAP8L silencing in cells treated with scrambled shRNA (shCon) or shRNA against AKAP8L (shAKAP8L-1, shAKAP8L-2). B Representative images and quantification analysis of spheroids in AKAP8L overexpression or the control groups, and AKAP8L knockdown or the control groups. Scale bar indicates 50 μm. C In soft agar colony formation assay, representative images and numbers of spheroids formed by AKAP8L-overexpressing and AKAP8L-knockdown BGC-823/Oxa and MKN-45/Oxa. Scale bar indicates 50 μm. D, E qPCR and Western blot assays showed the expression of stem cell markers induced by AKAP8L or AKAP8L shRNAs. The values indicate the mean +/- standard deviation (SD) of three independent experiments. *P < 0.05, **P < 0.01,***P < 0.001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36522343), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
HA95/AKAP8L Antibody - BSA Free

Knockdown Validated: HA95/AKAP8L Antibody - BSA Free [NBP2-47440] -

AKAP8L promotes the chemoresistance of GC cells.A Cell viability was measured by MTT in AKAP8L-overexpressing cells and AKAP8L silencing cells after the treatments of Oxa. B Representative images of flow cytometry showed the percentage of apoptotic cells in AKAP8L or AKAP8L shRNA transfected cells. C Representative images and quantification analysis of TUNEL assay. D Apoptosis-related proteins were measured in AKAP8L overexpression or AKAP8L knockdown GC cells. Scale bar indicates 50 μm. The values indicate the mean +/- SD of three independent experiments.*P < 0.05, **P < 0.01,***P < 0.001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36522343), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
HA95/AKAP8L Antibody - BSA Free

Knockdown Validated: HA95/AKAP8L Antibody - BSA Free [NBP2-47440] -

AKAP8L controls the chemoresistance in vivo.A 1 × 106 AKAP8L-overexpressing or AKAP8L-knockdown BGC-823/Oxa were implanted in nude mice (tumor development following treatment with Oxa once a week), tumors were dissected and representative images of the tumors are shown. B, C Tumor growth curves for orthotopic models. D Representative images of immunofluorescence staining of AKAP8L, Ki-67 and quantification analysis of AKAP8L, Ki-67 positive cells in xenograft tumors. Scale bar indicates 50 μm. E, F qPCR and Western blot analysis of the expression of AKAP8L, Lgr5, CD133, CD44, Oct4, and Sox2 in xenograft tumors. G Representative immunohistochemical staining of AKAP8L and CD133 in the indicated tumor tissues. Scale bar indicates 20 μm. H Immunofluorescence staining of TUNEL was performed to evaluate the apoptotic cells. Scale bar indicates 50 μm. I Western blot analysis of cleaved-caspase 3 and cleaved-PAPR. The values indicate the mean +/- SD of three independent experiments. *P < 0.05, **P < 0.01, ***P < 0.001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36522343), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
HA95/AKAP8L Antibody - BSA Free

Knockdown Validated: HA95/AKAP8L Antibody - BSA Free [NBP2-47440] -

AKAP8L controls the chemoresistance in vivo.A 1 × 106 AKAP8L-overexpressing or AKAP8L-knockdown BGC-823/Oxa were implanted in nude mice (tumor development following treatment with Oxa once a week), tumors were dissected and representative images of the tumors are shown. B, C Tumor growth curves for orthotopic models. D Representative images of immunofluorescence staining of AKAP8L, Ki-67 and quantification analysis of AKAP8L, Ki-67 positive cells in xenograft tumors. Scale bar indicates 50 μm. E, F qPCR and Western blot analysis of the expression of AKAP8L, Lgr5, CD133, CD44, Oct4, and Sox2 in xenograft tumors. G Representative immunohistochemical staining of AKAP8L and CD133 in the indicated tumor tissues. Scale bar indicates 20 μm. H Immunofluorescence staining of TUNEL was performed to evaluate the apoptotic cells. Scale bar indicates 50 μm. I Western blot analysis of cleaved-caspase 3 and cleaved-PAPR. The values indicate the mean +/- SD of three independent experiments. *P < 0.05, **P < 0.01, ***P < 0.001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36522343), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for HA95/AKAP8L Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICCIF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HA95/AKAP8L

AKAP8L/HA95 is a PKA anchoring protein that is localized to the nuclear envelope and associates with chromatin upon nuclear envelope breakdown during mitosis. AKAP8L/HA95 has been found to play an important role in the initiation of DNA replication and may function as a scaffold for proteins such as MCM2 and LAP2beta. Additionally, AKAP8L/HA95 has been shown to co-locate with the PKA C subunit in splicing factor compartments and is involved in the regulation of pre-mRNA splicing. Further support for a scaffolding and splicing role in the nucleus comes from the observation that AKAP8L/HA95 colocalizes with HypA, a splicing-like factor, and through this association may function as a docking site for the nuclear accumulation of Huntington protein as seen in Huntington's disease.

Alternate Names

A kinase (PRKA) anchor protein 8-like, AKAP8-like protein, HA95, HAP95 DKFZp434L0650, helicase A-binding protein 95 kDa, Homologous to AKAP95 protein, HRIHFB2018, NAKAP, NAKAP95 A-kinase anchor protein 8-like, neighbor of A kinase anchoring protein 95, Neighbor of AKAP95, Neighbor of A-kinase-anchoring protein 95

Gene Symbol

AKAP8L

Additional HA95/AKAP8L Products

Product Documents for HA95/AKAP8L Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HA95/AKAP8L Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for HA95/AKAP8L Antibody - BSA Free

Customer Reviews for HA95/AKAP8L Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HA95/AKAP8L Antibody - BSA Free and earn rewards!

Have you used HA95/AKAP8L Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...