HABP1/C1QBP/GC1q R Antibody (6N7U3)

Novus Biologicals | Catalog # NBP3-15368

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6N7U3 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human HABP1/C1QBP/GC1q R (Q07021). KTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HABP1/C1QBP/GC1q R Antibody (6N7U3)

Western Blot: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368]

Western Blot: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368]

Western Blot: HABP1/C1QBP/GC1q R Antibody (4T1W10) [NBP3-15368] - Western blot analysis of extracts of various cell lines, using HABP1/C1QBP/GC1q R antibody (NBP3-15368) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368]

Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368]

Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (4T1W10) [NBP3-15368] - Immunohistochemistry of paraffin-embedded rat ovary using HABP1/C1QBP/GC1q R antibody (NBP3-15368) at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368]

Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368]

Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (4T1W10) [NBP3-15368] - Immunohistochemistry of paraffin-embedded human colon carcinoma using HABP1/C1QBP/GC1q R antibody (NBP3-15368) at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368]

Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368]

Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (4T1W10) [NBP3-15368] - Immunohistochemistry of paraffin-embedded human esophageal cancer using HABP1/C1QBP/GC1q R antibody (NBP3-15368) at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368]

Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368]

Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (4T1W10) [NBP3-15368] - Immunohistochemistry of paraffin-embedded mouse heart using HABP1/C1QBP/GC1q R antibody (NBP3-15368) at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368]

Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368]

Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (4T1W10) [NBP3-15368] - Immunohistochemistry of paraffin-embedded mouse kidney using HABP1/C1QBP/GC1q R antibody (NBP3-15368) at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368]

Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368]

Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (4T1W10) [NBP3-15368] - Immunohistochemistry of paraffin-embedded rat kidney using HABP1/C1QBP/GC1q R antibody (NBP3-15368) at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
HABP1/C1QBP/GC1q R Antibody (6N7U3)

Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] -

Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] - Immunohistochemistry analysis of HABP1/C1QBP/GC1q R in paraffin-embedded rat kidney tissue using HABP1/C1QBP/GC1q R Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
HABP1/C1QBP/GC1q R Antibody (6N7U3)

Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] -

Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] - Immunohistochemistry analysis of HABP1/C1QBP/GC1q R in paraffin-embedded mouse kidney tissue using HABP1/C1QBP/GC1q R Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
HABP1/C1QBP/GC1q R Antibody (6N7U3)

Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] -

Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] - Immunohistochemistry analysis of HABP1/C1QBP/GC1q R in paraffin-embedded human thyroid cancer tissue using HABP1/C1QBP/GC1q R Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
HABP1/C1QBP/GC1q R Antibody (6N7U3)

Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] -

Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] - Immunohistochemistry analysis of HABP1/C1QBP/GC1q R in paraffin-embedded human colon tissue using HABP1/C1QBP/GC1q R Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
HABP1/C1QBP/GC1q R Antibody (6N7U3)

Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] -

Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] - Immunohistochemistry analysis of HABP1/C1QBP/GC1q R in paraffin-embedded human liver tissue using HABP1/C1QBP/GC1q R Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
HABP1/C1QBP/GC1q R Antibody (6N7U3)

Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] -

Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] - Immunohistochemistry analysis of HABP1/C1QBP/GC1q R in paraffin-embedded human colon carcinoma tissue using HABP1/C1QBP/GC1q R Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for HABP1/C1QBP/GC1q R Antibody (6N7U3)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: HABP1/C1QBP

The human complement subcomponent C1q associates with C1r and C1s in order to yield the first component of the serum complement system. The protein encoded by this gene is known to bind to the globular heads of C1q molecules and inhibit C1 activation. This protein has also been identified as the p32 subunit of pre-mRNA splicing factor SF2, as well as a hyaluronic acid-binding protein. [provided by RefSeq]

Long Name

Hyaluronic Acid-binding Protein

Alternate Names

C1QBP, gC1qBP, gC1qR, SF2p32

Gene Symbol

C1QBP

Additional HABP1/C1QBP Products

Product Documents for HABP1/C1QBP/GC1q R Antibody (6N7U3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HABP1/C1QBP/GC1q R Antibody (6N7U3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HABP1/C1QBP/GC1q R Antibody (6N7U3)

There are currently no reviews for this product. Be the first to review HABP1/C1QBP/GC1q R Antibody (6N7U3) and earn rewards!

Have you used HABP1/C1QBP/GC1q R Antibody (6N7U3)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...