HADH Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54732

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to HADH(hydroxyacyl-Coenzyme A dehydrogenase) The peptide sequence was selected from the C terminal of HADH. Peptide sequence YPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for HADH Antibody - BSA Free

Western Blot: HADH Antibody [NBP1-54732]

Western Blot: HADH Antibody [NBP1-54732]

Western Blot: HADH Antibody [NBP1-54732] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.
Immunohistochemistry: HADH Antibody [NBP1-54732]

Immunohistochemistry: HADH Antibody [NBP1-54732]

Immunohistochemistry: HADH Antibody [NBP1-54732] - Human Liver Tissue Observed Staining: Cytoplasm in mitochondria of hepatocytes Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec.
Western Blot: HADH Antibody [NBP1-54732]

Western Blot: HADH Antibody [NBP1-54732]

Western Blot: HADH Antibody [NBP1-54732] - Titration: 0.2-1 ug/ml, Positive Control: Human heart.

Applications for HADH Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HADH

HADH functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia. This gene is a member of the 3-hydroxyacyl-CoA dehydrogenase gene family. The encoded protein functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia. The human genome contains a related pseudogene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

EC 1.1.1, EC 1.1.1.35, HADH1, HADHSChydroxyacyl-Coenzyme A dehydrogenase, HCDH, hydroxyacyl-CoA dehydrogenase, L-3-hydroxyacyl-Coenzyme A dehydrogenase, short chain, Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase, MGC8392, mitochondrial, MSCHAD, SCHADHHF4

Gene Symbol

HADH

UniProt

Additional HADH Products

Product Documents for HADH Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HADH Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HADH Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HADH Antibody - BSA Free and earn rewards!

Have you used HADH Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...