HBG1/2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09322

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Hbe1 (NP_001008890). Peptide sequence MVNFTAEEKSLINGLWSKVNVEEVGGEALGRLLVVYPWTQRFFDSFGNLS

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

16 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for HBG1/2 Antibody - BSA Free

Western Blot: HBG1/2 Antibody [NBP3-09322]

Western Blot: HBG1/2 Antibody [NBP3-09322]

Western Blot: Hemoglobin gamma-2 chain Antibody [NBP3-09322] - Western blot analysis of Hemoglobin gamma-2 chain in Rat Stomach as a positive control. Antibody dilution at 1.0 ug/ml

Applications for HBG1/2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HBG1/2

The gamma globin genes (HBG1 and HBG2) are normally expressed in the fetal liver, spleen and bone marrow. Two gamma chains together with two alpha chains constitute fetal hemoglobin (HbF) which is normally replaced by adult hemoglobin (HbA) at birth. In some beta-thalassemias and related conditions, gamma chain production continues into adulthood. The two types of gamma chains differ at residue 136 where glycine is found in the G-gamma product (HBG2) and alanine is found in the A-gamma product (HBG1). The former is predominant at birth. The order of the genes in the beta-globin cluster is: 5'-epsilon -- gamma-G -- gamma-A -- delta -- beta--3'.

Alternate Names

abnormal hemoglobin, A-gamma globin, gamma A hemoglobin, gamma globin, Gamma-1-globin, gamma-2-globin, gamma-globin chain, G-gamma globin Paulinia, Hb F Agamma, hb F Ggamma, HBGA, HBGR, HBG-T1, HBG-T2, Hemoglobin gamma-1 chain, hemoglobin gamma-2 chain, Hemoglobin gamma-A chain, hemoglobin gamma-G chain, hemoglobin subunit gamma-1, hemoglobin subunit gamma-2, hemoglobin, gamma A, hemoglobin, gamma G, hemoglobin, gamma, regulator of, HSGGL1, methemoglobin, PRO2979, TNCY

Gene Symbol

HBG1

Additional HBG1/2 Products

Product Documents for HBG1/2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HBG1/2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HBG1/2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HBG1/2 Antibody - BSA Free and earn rewards!

Have you used HBG1/2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...