HEY2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57809

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Rat (90%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKK

Reactivity Notes

Mouse (88%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HEY2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: HEY2 Antibody [NBP2-57809]

Immunocytochemistry/ Immunofluorescence: HEY2 Antibody [NBP2-57809]

Immunocytochemistry/Immunofluorescence: HEY2 Antibody [NBP2-57809] - Staining of human cell line HEK 293 shows localization to nuclear bodies & aggresome.
HEY2 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: HEY2 Antibody - BSA Free [NBP2-57809]

Chromatin Immunoprecipitation-exo-Seq: HEY2 Antibody - BSA Free [NBP2-57809]

ChIP-Exo-Seq composite graph for Anti-HEY2 (NBP2-57809) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for HEY2 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HEY2

The HEY2 gene encodes a member of the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix(bHLH)-type transcription factors. The encoded protein forms homo- or hetero-dimers that localize to the nucleus andinteract with a histone deacet

Alternate Names

BHLHB32, bHLHb32HES-related repressor protein 2, cardiovascular basic helix-loop-helix factor 1, Cardiovascular helix-loop-helix factor 1, CHF1, Class B basic helix-loop-helix protein 32, GRLGRIDLOCK, Hairy and enhancer of split-related protein 2, hairy/enhancer-of-split related with YRPW motif 2, hairy/enhancer-of-split related with YRPW motif protein 2, Hairy-related transcription factor 2, hCHF1, HERP, HERP1hHRT2, HESR2, HESR-2, HES-related repressor protein 1, HRT2, HRT-2, MGC10720, Protein gridlock homolog

Gene Symbol

HEY2

Additional HEY2 Products

Product Documents for HEY2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HEY2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HEY2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HEY2 Antibody - BSA Free and earn rewards!

Have you used HEY2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...