HGS Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35799

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 548-777 of human HGS (NP_004703.1).

Sequence:
EQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQPAPAAGPYPSMPSTAADPSMVSAYMYPAGATGAQAAPQAQAGPTASPAYSSYQPTPTAGYQNVASQAPQSLPAISQPPQSSTMGYMGSQSVSMGYQPYNMQNLMTTLPSQDASLPPQQPYIAGQQPMYQQMAPSGGPPQQQPPVAQQPQAQGPPAQGSEAQLISFD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

86 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for HGS Antibody - BSA Free

HGS Antibody

Immunoprecipitation: HGS Antibody [NBP3-35799] -

Immunoprecipitation: HGS Antibody [NBP3-35799] - Immunoprecipitation analysis of 300 ug extracts of HepG2 cells using 3 ug HGS antibody. Western blot was performed from the immunoprecipitate using HGS antibody at a dilution of 1:1000.
HGS Antibody

Immunocytochemistry/ Immunofluorescence: HGS Antibody [NBP3-35799] -

Immunocytochemistry/ Immunofluorescence: HGS Antibody [NBP3-35799] - Immunofluorescence analysis of U-2 OS cells using HGS Rabbit pAb at dilution of 100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
HGS Antibody

Western Blot: HGS Antibody [NBP3-35799] -

Western Blot: HGS Antibody [NBP3-35799] - Western blot analysis of various lysates using HGS Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications for HGS Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunoprecipitation

0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: HGS

HGS is involved in intracellular signal transduction mediated by cytokines and growth factors. When associated with STAM, it suppresses DNA signaling upon stimulation by IL-2 and GM-CSF. Could be a direct effector of PI3-kinase in vesicular pathway via early end

Alternate Names

FLJ39878, hepatocyte growth factor-regulated tyrosine kinase substrate, Hrs, HRSFLJ11421, human growth factor-regulated tyrosine kinase substrate, Protein pp110, Vps27, ZFYVE8

Gene Symbol

HGS

Additional HGS Products

Product Documents for HGS Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HGS Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HGS Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HGS Antibody - BSA Free and earn rewards!

Have you used HGS Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...