HINT1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83257

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: IPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HINT1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: HINT1 Antibody [NBP1-83257]

Immunocytochemistry/ Immunofluorescence: HINT1 Antibody [NBP1-83257]

Immunocytochemistry/Immunofluorescence: HINT1 Antibody [NBP1-83257] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: HINT1 Antibody [NBP1-83257]

Immunohistochemistry-Paraffin: HINT1 Antibody [NBP1-83257]

Immunohistochemistry-Paraffin: HINT1 Antibody [NBP1-83257] - Staining of human gastrointestinal shows cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: HINT1 Antibody [NBP1-83257]

Immunohistochemistry-Paraffin: HINT1 Antibody [NBP1-83257]

Immunohistochemistry-Paraffin: HINT1 Antibody [NBP1-83257] - Staining of human cerebral cortex shows moderate positivity in neuropil.
Immunohistochemistry-Paraffin: HINT1 Antibody [NBP1-83257]

Immunohistochemistry-Paraffin: HINT1 Antibody [NBP1-83257]

Immunohistochemistry-Paraffin: HINT1 Antibody [NBP1-83257] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: HINT1 Antibody [NBP1-83257]

Immunohistochemistry-Paraffin: HINT1 Antibody [NBP1-83257]

Immunohistochemistry-Paraffin: HINT1 Antibody [NBP1-83257] - Staining of human thyroid gland shows moderate cytoplasmic and nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: HINT1 Antibody [NBP1-83257]

Immunohistochemistry-Paraffin: HINT1 Antibody [NBP1-83257]

Immunohistochemistry-Paraffin: HINT1 Antibody [NBP1-83257] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
HINT1 Antibody - BSA Free Western Blot: HINT1 Antibody - BSA Free [NBP1-83257]

Western Blot: HINT1 Antibody - BSA Free [NBP1-83257]

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue
HINT1 Antibody - BSA Free Western Blot: HINT1 Antibody - BSA Free [NBP1-83257]

Western Blot: HINT1 Antibody - BSA Free [NBP1-83257]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells))
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells))

Applications for HINT1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500-1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HINT1

Hydrolyzes adenosine 5'-monophosphoramidate substrates such as AMP-morpholidate, AMP-N-alanine methyl ester,AMP-alpha-acetyl lysine methyl ester and AMP-NH2

Alternate Names

Adenosine 5'-monophosphoramidase, EC 3.-, HINT, histidine triad nucleotide binding protein 1, histidine triad nucleotide-binding protein, histidine triad nucleotide-binding protein 1, PKCI1, PKCI-1FLJ30414, PRKCNH1FLJ32340, Protein kinase C inhibitor 1, Protein kinase C-interacting protein 1

Gene Symbol

HINT1

Additional HINT1 Products

Product Documents for HINT1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HINT1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HINT1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HINT1 Antibody - BSA Free and earn rewards!

Have you used HINT1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...