HLA DRB4 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # H00003126-B01P

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Mouse IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

HLA-DRB4 (NP_068818.4, 1 a.a. - 266 a.a.) full-length human protein. MVCLKLPGGSCMAALTVTLTVLSSPLALAGDTQPRFLEQAKCECHFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQWSARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFRNQKGHSGLQPTGLLS

Clonality

Polyclonal

Host

Mouse

Isotype

IgG

Description

Quality control test: Antibody reactive against mammalian transfected lysate.

Scientific Data Images for HLA DRB4 Antibody - Azide and BSA Free

Western Blot: HLA DRB4 Antibody [H00003126-B01P]

Western Blot: HLA DRB4 Antibody [H00003126-B01P]

Western Blot: HLA DRB4 Antibody [H00003126-B01P] - Analysis of HLA-DRB4 expression in Jurkat.
Western Blot: HLA DRB4 Antibody [H00003126-B01P]

Western Blot: HLA DRB4 Antibody [H00003126-B01P]

Western Blot: HLA DRB4 Antibody [H00003126-B01P] - Analysis of HLA-DRB4 expression in transfected 293T cell line by HLA-DRB4 polyclonal antibody. Lane 1: HLA-DRB4 transfected lysate(29.90 KDa). Lane 2: Non-transfected lysate.

Applications for HLA DRB4 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
It has been used for WB.

Formulation, Preparation, and Storage

Purification

Protein G purified

Formulation

PBS (pH 7.4)

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: HLA DRB4

HLA-DRB4 belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DRA) and a beta (DRB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DR molecule the beta chain contains all the polymorphisms specifying the peptide binding specificities. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. DRB1 is expressed at a level five times higher than its paralogues DRB3, DRB4 and DRB5. The presence of DRB4 is linked with allelic variants of DRB1, otherwise it is omitted. There are 4 related pseudogenes: DRB2, DRB6, DRB7, DRB8 and DRB9.

Alternate Names

class II histocompatibility antigen HLA DR alpha, beta1-0307, DR12, DR-12, DR13, DR-13, DR14, DR-14, DR4, DR-4, DRB1 transplantation antigen, DRB4, HLA class II histocompatibility antigen, DR beta 4 chain, HLA class II histocompatibility antigen, DRB1-12 beta chain, HLA class II histocompatibility antigen, DRB1-4 beta chain, HLA-DR4B, human leucocyte antigen DRB4, leucocyte antigen DRB1, leukocyte antigen, major histocompatibility complex, class II, DR beta 1, major histocompatibility complex, class II, DR beta 4, MHC class I antigen DRB1*12, MHC class I antigen DRB1*4, MHC class II antigen DRB1*12, MHC class II antigen DRB1*13, MHC class II antigen DRB1*14, MHC class II antigen DRB1*4, MHC class II antigen DRB4, MHC class II antigen HLA-DRB1, MHC class II antigen HLA-DR-beta, MHC class II HLA-DR-beta-7, MHC class2 antigen, MHC HLA DR-beta chain

Gene Symbol

HLA-DRB4

Additional HLA DRB4 Products

Product Documents for HLA DRB4 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HLA DRB4 Antibody - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HLA DRB4 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review HLA DRB4 Antibody - Azide and BSA Free and earn rewards!

Have you used HLA DRB4 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...