HMGA1 Antibody (5J0E6)

Novus Biologicals | Catalog # NBP3-16379

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation (ChIP)

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5J0E6 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-107 of human HMGA1 (P17096). MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

12 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for HMGA1 Antibody (5J0E6)

Western Blot: HMGA1 Antibody (5J0E6) [NBP3-16379]

Western Blot: HMGA1 Antibody (5J0E6) [NBP3-16379]

Western Blot: HMGA1 Antibody (5J0E6) [NBP3-16379] - Western blot analysis of extracts of various cell lines, using HMGA1 Rabbit mAb (NBP3-16379) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
HMGA1 Antibody (5J0E6)

Immunohistochemistry: HMGA1 Antibody (5J0E6) [NBP3-16379] -

Immunohistochemistry: HMGA1 Antibody (5J0E6) [NBP3-16379] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using HMGA1 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
HMGA1 Antibody (5J0E6)

Chromatin Immunoprecipitation: HMGA1 Antibody (5J0E6) [NBP3-16379] -

Chromatin Immunoprecipitation: HMGA1 Antibody (5J0E6) [NBP3-16379] - Chromatin immunoprecipitation was performed with 25 ug of cross-linked chromatin from HepG2 cells using 5 ug of HMGA1 Rabbit mAb. DNA libraries were prepared using Scale ssDNA-seq Lib Prep Kit for Illumina V2. The ChIP sequencing results indicate the enrichment pattern of HMGA1 across chromosome 12(upper panel) and the genomic region encompassing HNF1A, a representative gene enriched in HMGA1 (lower panel).
HMGA1 Antibody (5J0E6)

Immunohistochemistry: HMGA1 Antibody (5J0E6) [NBP3-16379] -

Immunohistochemistry: HMGA1 Antibody (5J0E6) [NBP3-16379] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using HMGA1 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
HMGA1 Antibody (5J0E6)

Immunohistochemistry: HMGA1 Antibody (5J0E6) [NBP3-16379] -

Immunohistochemistry: HMGA1 Antibody (5J0E6) [NBP3-16379] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using HMGA1 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
HMGA1 Antibody (5J0E6)

Immunohistochemistry: HMGA1 Antibody (5J0E6) [NBP3-16379] -

Immunohistochemistry: HMGA1 Antibody (5J0E6) [NBP3-16379] - Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using HMGA1 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
HMGA1 Antibody (5J0E6)

Western Blot: HMGA1 Antibody (5J0E6) [NBP3-16379] -

Western Blot: HMGA1 Antibody (5J0E6) [NBP3-16379] - Western blot analysis of lysates from Mouse testis, using HMGA1 Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
HMGA1 Antibody (5J0E6)

Chromatin Immunoprecipitation: HMGA1 Antibody (5J0E6) [NBP3-16379] -

Chromatin Immunoprecipitation: HMGA1 Antibody (5J0E6) [NBP3-16379] - Chromatin immunoprecipitation was performed with 25 ug of cross-linked chromatin from HepG2 cells using 5 ug of HMGA1 Rabbit mAb. DNA libraries were prepared using Scale ssDNA-seq Lib Prep Kit for Illumina V2. The ChIP sequencing results indicate the enrichment pattern of HMGA1 in the representative genomic region surrounding HNF1A gene.
HMGA1 Antibody (5J0E6)

Immunohistochemistry: HMGA1 Antibody (5J0E6) [NBP3-16379] -

Immunohistochemistry: HMGA1 Antibody (5J0E6) [NBP3-16379] - Immunohistochemistry analysis of paraffin-embedded Human breast tissue using HMGA1 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
HMGA1 Antibody (5J0E6)

Chromatin Immunoprecipitation: HMGA1 Antibody (5J0E6) [NBP3-16379] -

Chromatin Immunoprecipitation: HMGA1 Antibody (5J0E6) [NBP3-16379] - Chromatin immunoprecipitation analysis of extracts from HepG2 cells, using HMGA1 antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
HMGA1 Antibody (5J0E6)

Immunohistochemistry: HMGA1 Antibody (5J0E6) [NBP3-16379] -

Immunohistochemistry: HMGA1 Antibody (5J0E6) [NBP3-16379] - Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using HMGA1 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
HMGA1 Antibody (5J0E6)

Immunocytochemistry/ Immunofluorescence: HMGA1 Antibody (5J0E6) [NBP3-16379] -

Immunocytochemistry/ Immunofluorescence: HMGA1 Antibody (5J0E6) [NBP3-16379] - Confocal imaging of U-2 OS cells using HMGA1 Rabbit mAb. The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
HMGA1 Antibody (5J0E6)

Immunohistochemistry: HMGA1 Antibody (5J0E6) [NBP3-16379] -

Immunohistochemistry: HMGA1 Antibody (5J0E6) [NBP3-16379] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using HMGA1 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
HMGA1 Antibody (5J0E6)

Immunohistochemistry: HMGA1 Antibody (5J0E6) [NBP3-16379] -

Immunohistochemistry: HMGA1 Antibody (5J0E6) [NBP3-16379] - Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using HMGA1 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Applications for HMGA1 Antibody (5J0E6)

Application
Recommended Usage

Chromatin Immunoprecipitation (ChIP)

3ug antibody for 10ug-15ug of Chromatin

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:100 - 1:1000

Immunohistochemistry

1:2000 - 1:8000

Immunohistochemistry-Paraffin

1:2000 - 1:8000

Western Blot

1:1000 - 1:4000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: HMGA1

HMGA1 is expected to recognise isoform a (also called HMG-I; NP_665906.1; NP_665908.1; NP_665911.1) and isoform b (also called HMG-Y; NP_002122.1; NP_665909.1; NP_665910.1; NP_665912.1).

Alternate Names

high mobility group AT-hook 1, High mobility group AT-hook protein 1, High mobility group protein A1, high mobility group protein HMG-I/HMG-Y, High mobility group protein R, high-mobility group (nonhistone chromosomal) protein isoforms I and Y, HMGA1A, HMG-I(Y), HMGIYMGC12816, HMG-R, MGC4242, MGC4854, nonhistone chromosomal high-mobility group protein HMG-I/HMG-Y

Gene Symbol

HMGA1

Additional HMGA1 Products

Product Documents for HMGA1 Antibody (5J0E6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HMGA1 Antibody (5J0E6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HMGA1 Antibody (5J0E6)

There are currently no reviews for this product. Be the first to review HMGA1 Antibody (5J0E6) and earn rewards!

Have you used HMGA1 Antibody (5J0E6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...