hnRNP A2B1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89675

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKAL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for hnRNP A2B1 Antibody - BSA Free

hnRNP A2B1 Antibody - BSA Free Immunohistochemistry-Paraffin: hnRNP A2B1 Antibody - BSA Free [NBP1-89675]

Immunohistochemistry-Paraffin: hnRNP A2B1 Antibody - BSA Free [NBP1-89675]

Staining of human small intestine shows strong nuclear positivity in glandular cells.
hnRNP A2B1 Antibody - BSA Free Immunohistochemistry-Paraffin: hnRNP A2B1 Antibody - BSA Free [NBP1-89675]

Immunohistochemistry-Paraffin: hnRNP A2B1 Antibody - BSA Free [NBP1-89675]

Staining of human endometrium shows moderate nuclear positivity in glandular cells.
hnRNP A2B1 Antibody - BSA Free Immunohistochemistry-Paraffin: hnRNP A2B1 Antibody - BSA Free [NBP1-89675]

Immunohistochemistry-Paraffin: hnRNP A2B1 Antibody - BSA Free [NBP1-89675]

Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
hnRNP A2B1 Antibody - BSA Free Immunohistochemistry-Paraffin: hnRNP A2B1 Antibody - BSA Free [NBP1-89675]

Immunohistochemistry-Paraffin: hnRNP A2B1 Antibody - BSA Free [NBP1-89675]

Staining of human lymph node shows strong nuclear positivity in non-germinal center cells.
hnRNP A2B1 Antibody - BSA Free Western Blot: hnRNP A2B1 Antibody - BSA Free [NBP1-89675]

Western Blot: hnRNP A2B1 Antibody - BSA Free [NBP1-89675]

Analysis in human cell line Daudi.
Knockdown Validated: hnRNP A2B1 Antibody [NBP1-89675]

Western Blot: hnRNP A2B1 Antibody [NBP1-89675]

Western Blot: hnRNP A2B1 Antibody [NBP1-89675] - Western blot shows lysates of HEK293T human embryonic kidney parental cell line and hnRNP A1 knockout (KO) HEK293T cell line. PVDF membrane was probed with 0.4 ug/ml of Rabbit Anti-Human hnRNP A1 Polyclonal Antibody (Catalog # NBP1-89675) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for hnRNP A1 at approximately 35 kDa (as indicated) in the parental HEK293T cell line, but is not detectable in the knockout HEK293T cell line. This experiment was conducted under reducing conditions.
hnRNP A2B1 Antibody - BSA Free Western Blot: hnRNP A2B1 Antibody - BSA Free [NBP1-89675]

Western Blot: hnRNP A2B1 Antibody - BSA Free [NBP1-89675]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Applications for hnRNP A2B1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: hnRNP A2B1

RNA polymerase II transcripts in the nucleus are in complex with several different proteins called heterogeneous nuclear ribonucleoproteins (hnRNPs). These proteins act in biological activities such as transcription, pre-mRNA processing, cytoplasmic mRNA ranslation, and turnover.2. hnRNPs can be isolated either by immunoprecipitation or by sucrose gradient fractionation of cell extracts. Isolated hnRNPs consist of protein groups named A to U and many of these protein groups consist of more than one isoform.3 The major steadystate proteins of the isolated hnRNP complex are the A1, A2, B1, B2, C1, and C2 with a range of molecular weights (34-43 kDa).3 hnRNP-A2/B1 proteins are located in the nucleus of most tissues cells; however, the hnRNP-A2 protein is found also in the cytoplasm of skin and esophagus cells. In rat brain, hnRNP-A2/B1 proteins are found in neurons in the cerebral cortices, hippocampal formation, olfactory regions, caudate-putamin, and the supraoptic ucleus of the hypothalamus.4 Expression of hnRNP-A2/B1 proteins was found also in lung development and its over expression correlated with lung cancer.5

Alternate Names

DKFZp779B0244, FLJ22720, heterogeneous nuclear ribonucleoprotein A2/B1, heterogeneous nuclear ribonucleoprotein B1, heterogeneous nuclear ribonucleoproteins A2/B1, hnRNP A2 / hnRNP B1, HNRNPA2, HNRNPB1, HNRPA2, HNRPA2B1hnRNP A2/B1, HNRPB1, nuclear ribonucleoprotein particle A2 protein, RNPA2, SNRPB1

Gene Symbol

HNRNPA2B1

Additional hnRNP A2B1 Products

Product Documents for hnRNP A2B1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for hnRNP A2B1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for hnRNP A2B1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review hnRNP A2B1 Antibody - BSA Free and earn rewards!

Have you used hnRNP A2B1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...