HOXA7 Antibody (2F2) - Azide and BSA Free

Novus Biologicals | Catalog # H00003204-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 2F2

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

HOXA7 (NP_008827, 58 a.a. ~ 112 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NSPLYQSPFASGYGLGADAYGNLPCASYDQNIPGLCSDLAKGACDKTDEGALHGA

Specificity

HOXA7 - homeo box A7

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for HOXA7 Antibody (2F2) - Azide and BSA Free

Western Blot: HOXA7 Antibody (2F2) [H00003204-M01]

Western Blot: HOXA7 Antibody (2F2) [H00003204-M01]

Western Blot: HOXA7 Antibody (2F2) [H00003204-M01] - Analysis of HOXA7 expression in transfected 293T cell line by HOXA7 monoclonal antibody (M01), clone 2F2.Lane 1: HOXA7 transfected lysate(25.4 KDa).Lane 2: Non-transfected lysate.
Sandwich ELISA: HOXA7 Antibody (2F2) [H00003204-M01] - Detection limit for recombinant GST tagged HOXA7 is approximately 0.1ng/ml as a capture antibody.

Applications for HOXA7 Antibody (2F2) - Azide and BSA Free

Application
Recommended Usage

Sandwich ELISA

1:100-1:2000

Western Blot

1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: HOXA7

In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. For example, the encoded protein represses the transcription of differentiation-specific genes during keratinocyte proliferation, but this repression is then overcome by differentiation signals. This gene is highly similar to the antennapedia (Antp) gene of Drosophila.

Alternate Names

ANTP, homeo box A7, homeobox A7, Homeobox protein Hox 1.1, Homeobox protein Hox-1A, homeobox protein Hox-A7, HOX1.1, HOX1AHOX1

Entrez Gene IDs

3204 (Human)

Gene Symbol

HOXA7

OMIM

142950 (Human)

Additional HOXA7 Products

Product Documents for HOXA7 Antibody (2F2) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HOXA7 Antibody (2F2) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for HOXA7 Antibody (2F2) - Azide and BSA Free

Customer Reviews for HOXA7 Antibody (2F2) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review HOXA7 Antibody (2F2) - Azide and BSA Free and earn rewards!

Have you used HOXA7 Antibody (2F2) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...