HOXD11 Antibody (8C7) - Azide and BSA Free

Novus Biologicals | Catalog # H00003237-M02

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 8C7

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

HOXD11 (NP_067015, 1 a.a. ~ 76 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNDFDECGQSAASMYLPGCAYYVAPSDFASKPSFLSQPSSCQMTFPYSSNLAPHVQPVREVAFRDYGLERAKWPYR

Specificity

HOXD11 - homeobox D11

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for HOXD11 Antibody (8C7) - Azide and BSA Free

Western Blot: HOXD11 Antibody (8C7) [H00003237-M02]

Western Blot: HOXD11 Antibody (8C7) [H00003237-M02]

Western Blot: HOXD11 Antibody (8C7) [H00003237-M02] - Detection against Immunogen (34.1 KDa).

Applications for HOXD11 Antibody (8C7) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: HOXD11

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located in a cluster on chromosome 2. Deletions that remove the entire HOXD gene cluster or the 5' end of this cluster have been associated with severe limb and genital abnormalities. The product of the mouse Hoxd11 gene plays a role in forelimb morphogenesis.

Alternate Names

homeo box D11, homeobox D11, Homeobox protein Hox-4F, homeobox protein Hox-D11, HOX4, Hox-4.6, mouse, homolog of, HOX4Fhomeo box 4F

Entrez Gene IDs

3237 (Human)

Gene Symbol

HOXD11

OMIM

142986 (Human)

Additional HOXD11 Products

Product Documents for HOXD11 Antibody (8C7) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HOXD11 Antibody (8C7) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HOXD11 Antibody (8C7) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review HOXD11 Antibody (8C7) - Azide and BSA Free and earn rewards!

Have you used HOXD11 Antibody (8C7) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...