HSPH1/HSP105 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55047

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IGRFVVQNVSAQKDGEKSRVKVKVRVNTHGIFTISTASMVEKVPTEENEMSSEADMECLNQRPPENPDTDKNVQQDNSEAG

Reactivity Notes

Mouse (88%), Rat ( 85%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HSPH1/HSP105 Antibody - BSA Free

Western Blot: HSPH1/HSP105 Antibody [NBP2-55047]

Western Blot: HSPH1/HSP105 Antibody [NBP2-55047]

Western Blot: HSPH1/HSP105 Antibody [NBP2-55047] - Analysis using Anti-HSPH1 antibody NBP2-55047 (A) shows similar pattern to independent antibody NBP1-89662 (B).
Immunocytochemistry/ Immunofluorescence: HSPH1/HSP105 Antibody [NBP2-55047]

Immunocytochemistry/ Immunofluorescence: HSPH1/HSP105 Antibody [NBP2-55047]

Immunocytochemistry/Immunofluorescence: HSPH1/HSP105 Antibody [NBP2-55047] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.

Applications for HSPH1/HSP105 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HSPH1

The heat shock proteins (HSPs) comprise a group of highly conserved, abundantly expressed proteins with diverse functions, including the assembly and sequestering of multiprotein complexes, transportation of nascent polypeptide chains across cellular membranes and regulation of protein folding. Heat shock proteins (also known as molecular chaperones) fall into six general families: HSP 90, HSP 70, HSP 60, the low molecular weight HSPs, the immunophilins and the HSP 110 family. The HSP 110 family (also known as the HSP 105 family) is composed of HSP 105, Apg-1 and Apg-2. HSP 105 is a testis-specific and HSP 90-related protein. Research indicates that HSP 105 is specifically localized in the germ cells and may translocate into the nucleus after heat shock. It is suggested that HSP 105 may contribute to the stabilization of p53 proteins in the cytoplasm of the germ cells, preventing the potential induction of apoptosis by p53.

Long Name

Heat Shock Protein H1

Alternate Names

HSP105a, HSP110, NY-CO-25

Gene Symbol

HSPH1

Additional HSPH1 Products

Product Documents for HSPH1/HSP105 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HSPH1/HSP105 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for HSPH1/HSP105 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HSPH1/HSP105 Antibody - BSA Free and earn rewards!

Have you used HSPH1/HSP105 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...