Hydrogen Potassium ATPase Beta Antibody (3Y1Y1)

Novus Biologicals | Catalog # NBP3-15739

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 3Y1Y1 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 192-291 of human Hydrogen Potassium ATPase Beta (P51164). SNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Hydrogen Potassium ATPase Beta Antibody (3Y1Y1)

Western Blot: Hydrogen Potassium ATPase Beta Antibody (3Y1Y1) [NBP3-15739]

Western Blot: Hydrogen Potassium ATPase Beta Antibody (3Y1Y1) [NBP3-15739]

Western Blot: Hydrogen Potassium ATPase Beta Antibody (3Y1Y1) [NBP3-15739] - Western blot analysis of extracts of various cell lines, using Hydrogen Potassium ATPase Beta antibody (NBP3-15739) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunohistochemistry-Paraffin: Hydrogen Potassium ATPase Beta Antibody (3Y1Y1) [NBP3-15739]

Immunohistochemistry-Paraffin: Hydrogen Potassium ATPase Beta Antibody (3Y1Y1) [NBP3-15739]

Immunohistochemistry-Paraffin: Hydrogen Potassium ATPase Beta Antibody (3Y1Y1) [NBP3-15739] - Immunohistochemistry of paraffin-embedded mouse stomach using Hydrogen Potassium ATPase Beta Rabbit mAb (NBP3-15739) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Western Blot: Hydrogen Potassium ATPase Beta Antibody (3Y1Y1) [NBP3-15739]

Western Blot: Hydrogen Potassium ATPase Beta Antibody (3Y1Y1) [NBP3-15739]

Western Blot: Hydrogen Potassium ATPase Beta Antibody (3Y1Y1) [NBP3-15739] - Western blot analysis of extracts of Mouse stomach, using Hydrogen Potassium ATPase Beta antibody (NBP3-15739) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.
Immunohistochemistry-Paraffin: Hydrogen Potassium ATPase Beta Antibody (3Y1Y1) [NBP3-15739]

Immunohistochemistry-Paraffin: Hydrogen Potassium ATPase Beta Antibody (3Y1Y1) [NBP3-15739]

Immunohistochemistry-Paraffin: Hydrogen Potassium ATPase Beta Antibody (3Y1Y1) [NBP3-15739] - Immunohistochemistry of paraffin-embedded rat stomach using Hydrogen Potassium ATPase Beta Rabbit mAb (NBP3-15739) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Applications for Hydrogen Potassium ATPase Beta Antibody (3Y1Y1)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Hydrogen Potassium ATPase Beta

The hydrogen/potassium ATPase, or gastric proton pump, belongs to a family of P-type cation-transporting ATPases. This family of ATPases shares a number of functional and structural similarities including the common feature of consisting of an alpha and beta subunit. Like the ubiquitous sodium/potassium ATPase, the hydrogen/potassium ATPase consists of a large transmembrane catalytic subunit, termed the alpha-subunit which contains sites for ATP binding and phosphorylation, and an associated smaller glycoprotein, termed the beta-subunit which may play a role in maintaining the structural and functional integrity of the complex.

Long Name

Potassium-transporting ATPase subunit beta

Alternate Names

ATP4B

Gene Symbol

ATP4B

Additional Hydrogen Potassium ATPase Beta Products

Product Documents for Hydrogen Potassium ATPase Beta Antibody (3Y1Y1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Hydrogen Potassium ATPase Beta Antibody (3Y1Y1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Hydrogen Potassium ATPase Beta Antibody (3Y1Y1)

There are currently no reviews for this product. Be the first to review Hydrogen Potassium ATPase Beta Antibody (3Y1Y1) and earn rewards!

Have you used Hydrogen Potassium ATPase Beta Antibody (3Y1Y1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...