IFI44L Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-57838
![Western Blot: IFI44L Antibody [NBP1-57838]](https://resources.rndsystems.com/images/products/IFI44L-Antibody-Western-Blot-NBP1-57838-img0001.jpg "Western Blot: IFI44L Antibody [NBP1-57838]")
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Cited:
IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to IFI44L(interferon-induced protein 44-like) The peptide sequence was selected from the N terminal of IFI44L. Peptide sequence MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCT. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for IFI44L Antibody - BSA Free
Western Blot: IFI44L Antibody [NBP1-57838]
Western Blot: IFI44L Antibody [NBP1-57838] - Jurkat cell lysate, concentration 5.0ug/ml.![Immunohistochemistry-Paraffin: IFI44L Antibody [NBP1-57838]](https://resources.rndsystems.com/images/products/IFI44L-Antibody-Immunohistochemistry-Paraffin-NBP1-57838-img0002.jpg "Immunohistochemistry-Paraffin: IFI44L Antibody [NBP1-57838]")
Immunohistochemistry-Paraffin: IFI44L Antibody [NBP1-57838]
Immunohistochemistry-Paraffin: IFI44L Antibody [NBP1-57838] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Immunohistochemistry: IFI44L Antibody [NBP1-57838] -
Immunohistochemistry: IFI44L Antibody [NBP1-57838] - Overexpression of IFI44L gene inhibited the proliferation, migration, & invasion of NSCLC cells. (A, B) CCK-8 assay was used to detect the effect of IFI44L overexpression on NSCLC cell growth. (C–F) The cell migration was detected after overexpression of IFI44L gene by scratch healing tests. Bar equals 100 µm. (G–J) Overexpression of IFI44L inhibited the migration & invasion of NSCLC cells by transwell assay. Bar equals 50 µm. NSCLC, non-small cell lung cancer; CCK-8: cell counting kit-8; *p < 0.05, **p < 0.01, ***p < 0.001. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/35047409), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Immunohistochemistry: IFI44L Antibody [NBP1-57838] -
Immunohistochemistry: IFI44L Antibody [NBP1-57838] - Verification of the prognostic value & immune implication of IFI44L in NSCLC. (A) Representative IHC images of IFI44L in TMA cohort with the scale bar equal to 50 µm. (B) The correlation of IFI44L expression with OS among 97 NSCLC patients. (C) Univariate Cox regression analysis regarding the expression of IFI44L & other clinical parameters. (D) Multivariate Cox regression analysis about the expression of IFI44L & clinical parameters. (E, F) The expression levels of the related immunomodulators were detected in NSCLC cells after overexpression of IFI44L. NSCLC, non-small cell lung cancer; OS, overall survival; LUAD, lung adenocarcinoma; IHC, immunohistochemistry; TMA, tissue microarray; **p < 0.01, ***p < 0.001. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/35047409), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for IFI44L Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:10-1:500
Immunohistochemistry-Paraffin
1:10-1:500
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Protein A purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
1 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: IFI44L
Alternate Names
C1orf29, chromosome 1 open reading frame 29, GS3686, interferon-induced protein 44-like
Gene Symbol
IFI44L
UniProt
Additional IFI44L Products
Product Documents for IFI44L Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for IFI44L Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for IFI44L Antibody - BSA Free
Powered by Bioz
Customer Reviews for IFI44L Antibody - BSA Free
There are currently no reviews for this product. Be the first to review IFI44L Antibody - BSA Free and earn rewards!
Have you used IFI44L Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...