Ikaros/IKZF1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-98314
Loading...
Key Product Details
Species Reactivity
Validated:
Mouse
Cited:
Human
Applications
Validated:
Western Blot
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen for this antibody is Ikzf1 - N-terminal region. Peptide sequence: RDALTGHLRTHSVGKPHKCGYCGRSYKQRSSLEEHKERCHNYLESMGLPG The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for Ikaros/IKZF1 Antibody - BSA Free
Western Blot: Ikaros/IKZF1 Antibody [NBP1-98314]
Western Blot: Ikaros/IKZF1 Antibody [NBP1-98314] - Mouse Small Intestine Lysate 1.0ug/ml, Gel Concentration: 12%Western Blot: Ikaros/IKZF1 Antibody - BSA Free [NBP1-98314] -
LG100754 attenuates tumor growth and prolongs survival of mice injected with lenalidomide-resistant human MM cells. (A) Representative images of SCID mice with subcutaneous MM tumor. (B) Body weight was measured every 3 days and presented as means +/- SD. (C) LG100754 enhanced lenalidomide-induced attenuations of tumor growth in severe combined immunodeficient mice. (D) Overall survival was evaluated using Kaplan–Meier curve and long-rank analysis from the first day of tumor cell injection until death or occurrence of an event. (E) Tumors treated as above were analyzed by immunoblotting with indicated antibodies. (F) LG100754 reduced the blood glucose level and decrease lipid accumulation. (Left) Approximately 5 mg/kg LG100754 was injected intraperitoneally into mice. Blood glucose level was measured using glucose meter at indicated timepoint. (Right) Approximately 5 mg/kg LG100754 was injected intraperitoneally into mice. Total blood lipid was measured using lipid quantification kit. *: p < 0.05; **: p < 0.01. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37566072), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: Ikaros/IKZF1 Antibody - BSA Free [NBP1-98314] -
Increased CRBN expression is associated with synergistic effect of lenalidomide and RXR agonists. (A) U266 and MM1.R were treated with indicated concentrations of RXR agonists for 48 h. Protein lysate was subjected to Western blot with indicated antibodies. (B) Representative images of CRBN in MM cells treated with DMSO or 8 uM LG100754, 4 uM bexarotene, 4 uM AGN194204, and 4 uM LG101506 for 48 h. Bar graphs display the results of the mean intensity of CRBN immunofluorescence of two groups. (C) U266 and MM1.R were treated with 10 uM lenalidomide and RXR agonists at concentrations indicated in (B) for 48 h. CRBN, caspase 3, and caspase 9 expression was measured by Western blot. (D) MM1.R and U266 cells were transduced with CRBN-specific CRISP/cas9 knockout vector for 24 h. Cells were then treated with lenalidomide alone, LG100754 alone, or in combination for additional 48 h with or without transduction of CRBN overexpressing plasmid. Cell viability was measured by MTT assay. Results are presented as mean +/- SD from at least three separate experiments. NS: not statistically significant; *: p < 0.05; **: p < 0.01. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37566072), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for Ikaros/IKZF1 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Ikaros
Long Name
DNA-binding protein Ikaros
Alternate Names
IK1, IKZF1, LyF-1, LYF1, PRO0758, ZNFN1A1
Gene Symbol
IKZF1
UniProt
Additional Ikaros Products
Product Documents for Ikaros/IKZF1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Ikaros/IKZF1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for Ikaros/IKZF1 Antibody - BSA Free
Customer Reviews for Ikaros/IKZF1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Ikaros/IKZF1 Antibody - BSA Free and earn rewards!
Have you used Ikaros/IKZF1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...