Inhibin alpha Antibody [Biotin]

This antibody was developed against Recombinant Protein corresponding to amino acids: QEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEPLLGLLALSPGGPVAVPMSLGHAPPHWAVLHLAT

Polyclonal

Rabbit

IgG

This conjugate is made on demand and is not held in inventory. Each order represents a unique lot. Successful site-specific biotin conjugation is confirmed by reducing SDS-PAGE, revealing a mobility shift of the antibody heavy-chain when biotin is covalently attached. Additional information may be available upon request. The antibody concentration is provided on the individual product label. For specialized conjugation needs, like large quantities, and specific concentrations, bulk and custom antibody conjugation services are available.

Affinity purified

40% glycerol and PBS (pH 7.2).

0.02% Sodium Azide

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Store at 4C in the dark.