Integrin alpha 2/CD49b Antibody (7O9H6)

Novus Biologicals | Catalog # NBP3-15644

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Knockout Validated, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7O9H6 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1082-1181 of human Integrin alpha 2/CD49b (P17301). GTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDEKAEVPTGVIIGSIIAGILLLLALVAILWKLGFFKRKYEKMTKNPDEIDETTELSS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

129 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Integrin alpha 2/CD49b Antibody (7O9H6)

Western Blot: Integrin alpha 2/CD49b Antibody (7O9H6) [NBP3-15644]

Western Blot: Integrin alpha 2/CD49b Antibody (7O9H6) [NBP3-15644]

Western Blot: Integrin alpha 2/CD49b Antibody (7O9H6) [NBP3-15644] - Analysis of extracts of various cell lines, using Integrin alpha 2/CD49b (ITGA2/CD49b) antibody (NBP3-15644) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Integrin alpha 2/CD49b Antibody (7O9H6)

Western Blot: Integrin alpha 2/CD49b Antibody (7O9H6) [NBP3-15644] -

Western Blot: Integrin alpha 2/CD49b Antibody (7O9H6) [NBP3-15644] - Analysis of lysates from A549 cells, using [KO Validated] Integrin alpha 2 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 1s.
Integrin alpha 2/CD49b Antibody (7O9H6)

Immunohistochemistry: Integrin alpha 2/CD49b Antibody (7O9H6) [Integrin alpha 2/CD49b] -

Immunohistochemistry: Integrin alpha 2/CD49b Antibody (7O9H6) [Integrin alpha 2/CD49b] - Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using [KO Validated] Integrin alpha 2/CD49b Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Integrin alpha 2/CD49b Antibody (7O9H6)

Immunohistochemistry: Integrin alpha 2/CD49b Antibody (7O9H6) [Integrin alpha 2/CD49b] -

Immunohistochemistry: Integrin alpha 2/CD49b Antibody (7O9H6) [Integrin alpha 2/CD49b] - Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using [KO Validated] Integrin alpha 2/CD49b Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Integrin alpha 2/CD49b Antibody (7O9H6)

Immunohistochemistry: Integrin alpha 2/CD49b Antibody (7O9H6) [Integrin alpha 2/CD49b] -

Immunohistochemistry: Integrin alpha 2/CD49b Antibody (7O9H6) [Integrin alpha 2/CD49b] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using [KO Validated] Integrin alpha 2/CD49b Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Integrin alpha 2/CD49b Antibody (7O9H6)

Immunohistochemistry: Integrin alpha 2/CD49b Antibody (7O9H6) [Integrin alpha 2/CD49b] -

Immunohistochemistry: Integrin alpha 2/CD49b Antibody (7O9H6) [Integrin alpha 2/CD49b] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using [KO Validated] Integrin alpha 2/CD49b Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Integrin alpha 2/CD49b Antibody (7O9H6)

Immunohistochemistry: Integrin alpha 2/CD49b Antibody (7O9H6) [Integrin alpha 2/CD49b] -

Immunohistochemistry: Integrin alpha 2/CD49b Antibody (7O9H6) [Integrin alpha 2/CD49b] - Immunohistochemistry analysis of paraffin-embedded Human breast tissue using [KO Validated] Integrin alpha 2/CD49b Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Integrin alpha 2/CD49b Antibody (7O9H6)

Immunohistochemistry: Integrin alpha 2/CD49b Antibody (7O9H6) [Integrin alpha 2/CD49b] -

Immunohistochemistry: Integrin alpha 2/CD49b Antibody (7O9H6) [Integrin alpha 2/CD49b] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using [KO Validated] Integrin alpha 2/CD49b Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Applications for Integrin alpha 2/CD49b Antibody (7O9H6)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunohistochemistry

1:200 - 1:800

Immunohistochemistry-Paraffin

1:200 - 1:800

Western Blot

1:1000 - 1:6000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Integrin alpha 2/CD49b

Integrins are heterodimeric cell surface receptors composed of alpha and beta subunits, which mediate cell-cell and cell-extracellular matrix attachments. They are responsible for adhesion of platelets and other cells to collagens, modulation of collagen and collagenase gene expression, force generation and organization of newly synthesized extracellular matrix. Aberrant integrin expression has been found in many epithelial tumours. Changes in integrin expression have been shown to be important for the growth and early metastatic capacity of melanoma cells.

Alternate Names

CD49b, ITGA2, VLA-2 alpha

Gene Symbol

ITGA2

Additional Integrin alpha 2/CD49b Products

Product Documents for Integrin alpha 2/CD49b Antibody (7O9H6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Integrin alpha 2/CD49b Antibody (7O9H6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Integrin alpha 2/CD49b Antibody (7O9H6)

There are currently no reviews for this product. Be the first to review Integrin alpha 2/CD49b Antibody (7O9H6) and earn rewards!

Have you used Integrin alpha 2/CD49b Antibody (7O9H6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies