IRF2BP2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-93674

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QDWVNRPKTVRDTLLALHQHGHSGPFESKFKKEPALTAGRLLGFEANGANGSKAVARTARKRKPSPEPEGEVG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for IRF2BP2 Antibody - BSA Free

Western Blot: IRF2BP2 Antibody [NBP1-93674]

Western Blot: IRF2BP2 Antibody [NBP1-93674]

Western Blot: IRF2BP2 Antibody [NBP1-93674] - Analysis in mouse cell line NIH-3T3 and rat cell ine NBT-II.
Western Blot: IRF2BP2 Antibody [NBP1-93674]

Western Blot: IRF2BP2 Antibody [NBP1-93674]

Western Blot: IRF2BP2 Antibody [NBP1-93674] - Analysis in human cell line THP-1.
IRF2BP2 Antibody - BSA Free Western Blot: IRF2BP2 Antibody - BSA Free [NBP1-93674]

Western Blot: IRF2BP2 Antibody - BSA Free [NBP1-93674]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
IRF2BP2 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: IRF2BP2 Antibody - BSA Free [NBP1-93674]

Immunocytochemistry/ Immunofluorescence: IRF2BP2 Antibody - BSA Free [NBP1-93674]

Staining of human cell line U-2 OS shows localization to nucleus.
IRF2BP2 Antibody - BSA Free Western Blot: IRF2BP2 Antibody - BSA Free [NBP1-93674]

Western Blot: IRF2BP2 Antibody - BSA Free [NBP1-93674]

Analysis in human cell line THP-1.
IRF2BP2 Antibody - BSA Free Immunohistochemistry: IRF2BP2 Antibody - BSA Free [NBP1-93674]

Immunohistochemistry: IRF2BP2 Antibody - BSA Free [NBP1-93674]

Staining of human prostate shows strong nuclear positivity in glandular cells.
IRF2BP2 Antibody - BSA Free Immunohistochemistry: IRF2BP2 Antibody - BSA Free [NBP1-93674]

Immunohistochemistry: IRF2BP2 Antibody - BSA Free [NBP1-93674]

Staining of human colon shows strong nuclear positivity in glandular cells.
IRF2BP2 Antibody - BSA Free Immunohistochemistry: IRF2BP2 Antibody - BSA Free [NBP1-93674]

Immunohistochemistry: IRF2BP2 Antibody - BSA Free [NBP1-93674]

Staining of human endometrium shows moderate nuclear positivity in glandular cells.
IRF2BP2 Antibody - BSA Free Immunohistochemistry: IRF2BP2 Antibody - BSA Free [NBP1-93674]

Immunohistochemistry: IRF2BP2 Antibody - BSA Free [NBP1-93674]

Staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.

Applications for IRF2BP2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IRF2BP2

Alternate Names

interferon regulatory factor 2 binding protein 2, IRF-2-binding protein 2

Gene Symbol

IRF2BP2

Additional IRF2BP2 Products

Product Documents for IRF2BP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for IRF2BP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for IRF2BP2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IRF2BP2 Antibody - BSA Free and earn rewards!

Have you used IRF2BP2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...