JAB1 Antibody (3X5F0)

Novus Biologicals | Catalog # NBP3-16328

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation (ChIP)

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 3X5F0 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human JAB1 (Q92905). MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPV

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for JAB1 Antibody (3X5F0)

Western Blot: JAB1 Antibody (3X5F0) [NBP3-16328]

Western Blot: JAB1 Antibody (3X5F0) [NBP3-16328]

Western Blot: JAB1 Antibody (3X5F0) [NBP3-16328] - Western blot analysis of extracts of various cell lines, using JAB1 Rabbit mAb (NBP3-16328) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
JAB1 Antibody (3X5F0)

Immunocytochemistry/ Immunofluorescence: JAB1 Antibody (3X5F0) [NBP3-16328] -

Immunocytochemistry/ Immunofluorescence: JAB1 Antibody (3X5F0) [NBP3-16328] - Immunofluorescence analysis of U-2 OS cells using JAB1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
JAB1 Antibody (3X5F0)

Immunocytochemistry/ Immunofluorescence: JAB1 Antibody (3X5F0) [NBP3-16328] -

Immunocytochemistry/ Immunofluorescence: JAB1 Antibody (3X5F0) [NBP3-16328] - Immunofluorescence analysis of NIH-3T3 cells using JAB1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
JAB1 Antibody (3X5F0)

Chromatin Immunoprecipitation: JAB1 Antibody (3X5F0) [NBP3-16328] -

Chromatin Immunoprecipitation: JAB1 Antibody (3X5F0) [NBP3-16328] - Chromatin immunoprecipitation analysis of extracts of HeLa cells, using JAB1 antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
JAB1 Antibody (3X5F0)

Immunohistochemistry: JAB1 Antibody (3X5F0) [NBP3-16328] -

Immunohistochemistry: JAB1 Antibody (3X5F0) [NBP3-16328] - Immunohistochemistry analysis of paraffin-embedded Human breast tissue using JAB1 Rabbit mAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
JAB1 Antibody (3X5F0)

Immunohistochemistry: JAB1 Antibody (3X5F0) [NBP3-16328] -

Immunohistochemistry: JAB1 Antibody (3X5F0) [NBP3-16328] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using JAB1 Rabbit mAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
JAB1 Antibody (3X5F0)

Immunohistochemistry: JAB1 Antibody (3X5F0) [NBP3-16328] -

Immunohistochemistry: JAB1 Antibody (3X5F0) [NBP3-16328] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using JAB1 Rabbit mAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
JAB1 Antibody (3X5F0)

Immunohistochemistry: JAB1 Antibody (3X5F0) [NBP3-16328] -

Immunohistochemistry: JAB1 Antibody (3X5F0) [NBP3-16328] - Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using JAB1 Rabbit mAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
JAB1 Antibody (3X5F0)

Immunohistochemistry: JAB1 Antibody (3X5F0) [NBP3-16328] -

Immunohistochemistry: JAB1 Antibody (3X5F0) [NBP3-16328] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using JAB1 Rabbit mAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
JAB1 Antibody (3X5F0)

Immunohistochemistry: JAB1 Antibody (3X5F0) [NBP3-16328] -

Immunohistochemistry: JAB1 Antibody (3X5F0) [NBP3-16328] - Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using JAB1 Rabbit mAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for JAB1 Antibody (3X5F0)

Application
Recommended Usage

Chromatin Immunoprecipitation (ChIP)

5μg antibody for 10μg-15μg of Chromatin

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: JAB1

The protein encoded by the JAB1 gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein is reported to be involved in the degradation of cyclin-dependent kinase inhibitor CDKN1B/p27Kip1. It is also known to be an coactivator that increases the specificity of JUN/AP1 transcription factors. (provided by RefSeq)

Long Name

Jun Activation Domain-binding Protein 1

Alternate Names

COPS5, CSN5, MOV-34, SGN5

Gene Symbol

COPS5

Additional JAB1 Products

Product Documents for JAB1 Antibody (3X5F0)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for JAB1 Antibody (3X5F0)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for JAB1 Antibody (3X5F0)

There are currently no reviews for this product. Be the first to review JAB1 Antibody (3X5F0) and earn rewards!

Have you used JAB1 Antibody (3X5F0)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...