Kif4A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56589

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (95%), Rat (93%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SITVEPSENLQSLMEKNQSLVEENEKLSRGLSEAAGQTAQMLERIILTEQANEKMNAKLEELRQHAACKLDLQKLVETLEDQELKE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Kif4A Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Kif4A Antibody [NBP2-56589]

Immunocytochemistry/ Immunofluorescence: Kif4A Antibody [NBP2-56589]

Immunocytochemistry/Immunofluorescence: Kif4A Antibody [NBP2-56589] - Staining of human cell line SiHa shows localization to nucleoplasm & cytokinetic bridge.
Kif4A Antibody - BSA Free Chromatin Immunoprecipitation ChIP: Kif4A Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: Kif4A Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-Kif4A tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

Applications for Kif4A Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Kif4A

The kinesin superfamily of proteins consists of over forty KIF motor proteins that function in intracellular transport along microtubules. Kinesin activity has been linked to various cellular functions such as vesicle transport, mitotic spindle formation, chromosome segregation, and cytokinesis. Structurally, all kinesins contain a motor domain with microtubule and nucleotide binding sites that utilize ATP to target cargo along microtubule filaments. KIF14 silencing experiments suggest that KIF14 plays a multi-functional role in mitosis and cytokinesis. KIF4A has been shown to be essential for cytokinesis. KIF4A is also known as kinesin family member 4A, chromosome-associated kinesin KIF4A, chromokinesin, KIF4, KIF4-G1, FLJ12530, FLJ12655, FLJ14204, FLJ20631, and HSA271784.

Alternate Names

chromokinesin-A, chromosome-associated kinesin KIF4A, FLJ12530, FLJ12655, FLJ14204, FLJ20631, HSA271784, KIF4G1, KIF4KIF4-G1, kinesin family member 4A

Gene Symbol

KIF4A

Additional Kif4A Products

Product Documents for Kif4A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Kif4A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Kif4A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Kif4A Antibody - BSA Free and earn rewards!

Have you used Kif4A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...