Lamin B1 Antibody (5H8V8)

Novus Biologicals | Catalog # NBP3-15393

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5H8V8 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 450-550 of human Lamin B1 (P20700). DGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTI

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Lamin B1 Antibody (5H8V8)

Western Blot: Lamin B1 Antibody (5H8V8) [NBP3-15393]

Western Blot: Lamin B1 Antibody (5H8V8) [NBP3-15393]

Western Blot: Lamin B1 Antibody (5H8V8) [NBP3-15393] - Western blot analysis of extracts of various cell lines, using Lamin B1 Rabbit mAb (NBP3-15393) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry-Paraffin: Lamin B1 Antibody (5H8V8) [NBP3-15393]

Immunohistochemistry-Paraffin: Lamin B1 Antibody (5H8V8) [NBP3-15393]

Immunohistochemistry-Paraffin: Lamin B1 Antibody (5H8V8) [NBP3-15393] - Immunohistochemistry of paraffin-embedded mouse testis using Lamin B1 Rabbit mAb (NBP3-15393) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Lamin B1 Antibody (5H8V8) [NBP3-15393]

Immunohistochemistry-Paraffin: Lamin B1 Antibody (5H8V8) [NBP3-15393]

Immunohistochemistry-Paraffin: Lamin B1 Antibody (5H8V8) [NBP3-15393] - Immunohistochemistry of paraffin-embedded rat spleen using Lamin B1 Rabbit mAb (NBP3-15393) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Lamin B1 Antibody (5H8V8) [NBP3-15393]

Immunohistochemistry-Paraffin: Lamin B1 Antibody (5H8V8) [NBP3-15393]

Immunohistochemistry-Paraffin: Lamin B1 Antibody (5H8V8) [NBP3-15393] - Immunohistochemistry of paraffin-embedded human colon using Lamin B1 Rabbit mAb (NBP3-15393) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Lamin B1 Antibody (5H8V8)

Immunohistochemistry: Lamin B1 Antibody (5H8V8) [Lamin B1] -

Immunohistochemistry: Lamin B1 Antibody (5H8V8) [Lamin B1] - Immunohistochemistry analysis of paraffin-embedded Rat liver using Lamin B1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Lamin B1 Antibody (5H8V8)

Immunohistochemistry: Lamin B1 Antibody (5H8V8) [Lamin B1] -

Immunohistochemistry: Lamin B1 Antibody (5H8V8) [Lamin B1] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using Lamin B1 Rabbit mAb at dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Lamin B1 Antibody (5H8V8)

Immunohistochemistry: Lamin B1 Antibody (5H8V8) [Lamin B1] -

Immunohistochemistry: Lamin B1 Antibody (5H8V8) [Lamin B1] - Immunohistochemistry analysis of paraffin-embedded Mouse liver using Lamin B1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Lamin B1 Antibody (5H8V8)

Immunohistochemistry: Lamin B1 Antibody (5H8V8) [Lamin B1] -

Immunohistochemistry: Lamin B1 Antibody (5H8V8) [Lamin B1] - Immunohistochemistry analysis of paraffin-embedded Human colon using Lamin B1 Rabbit mAb at dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Lamin B1 Antibody (5H8V8)

Immunohistochemistry: Lamin B1 Antibody (5H8V8) [Lamin B1] -

Immunohistochemistry: Lamin B1 Antibody (5H8V8) [Lamin B1] - Immunohistochemistry analysis of paraffin-embedded Rat kidney using Lamin B1 Rabbit mAb at dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Lamin B1 Antibody (5H8V8)

Immunohistochemistry: Lamin B1 Antibody (5H8V8) [Lamin B1] -

Immunohistochemistry: Lamin B1 Antibody (5H8V8) [Lamin B1] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer using Lamin B1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Lamin B1 Antibody (5H8V8)

Immunohistochemistry: Lamin B1 Antibody (5H8V8) [Lamin B1] -

Immunohistochemistry: Lamin B1 Antibody (5H8V8) [Lamin B1] - Immunohistochemistry analysis of paraffin-embedded Mouse colon using Lamin B1 Rabbit mAb at dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Lamin B1 Antibody (5H8V8)

Immunohistochemistry: Lamin B1 Antibody (5H8V8) [Lamin B1] -

Immunohistochemistry: Lamin B1 Antibody (5H8V8) [Lamin B1] - Immunohistochemistry analysis of paraffin-embedded Mouse testis using Lamin B1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Lamin B1 Antibody (5H8V8)

Immunohistochemistry: Lamin B1 Antibody (5H8V8) [Lamin B1] -

Immunohistochemistry: Lamin B1 Antibody (5H8V8) [Lamin B1] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using Lamin B1 Rabbit mAb at dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Lamin B1 Antibody (5H8V8)

Immunohistochemistry: Lamin B1 Antibody (5H8V8) [Lamin B1] -

Immunohistochemistry: Lamin B1 Antibody (5H8V8) [Lamin B1] - Immunohistochemistry analysis of paraffin-embedded Human brain using Lamin B1 Rabbit mAb at dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for Lamin B1 Antibody (5H8V8)

Application
Recommended Usage

Immunohistochemistry

1:100 - 1:500

Immunohistochemistry-Paraffin

1:100 - 1:500

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Lamin B1

Nuclear lamins form a network of intermediate-type filaments at the nucleoplasmic site of the nuclear membrane.Two main subtypes of nuclear lamins can be distinguished, i.e. A-type lamins and B-type lamins. The A-type lamins comprise a set of three proteins arising from the same gene by alternative splicing, i.e. lamin A, lamin C and lamin Adel 10, while the B-type lamins include two proteins arising from two distinct genes, i.e. lamin B1 and lamin B2.

Alternate Names

ADLD, LMN2, LMNB1

Gene Symbol

LMNB1

Additional Lamin B1 Products

Product Documents for Lamin B1 Antibody (5H8V8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Lamin B1 Antibody (5H8V8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Lamin B1 Antibody (5H8V8)

There are currently no reviews for this product. Be the first to review Lamin B1 Antibody (5H8V8) and earn rewards!

Have you used Lamin B1 Antibody (5H8V8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Lamin B1 Antibody (5H8V8)

Showing  1 - 1 of 1 FAQ Showing All
  • Q: I'm looking for human lamin antibodies that might cross react with Drosophila lamins. I've found a few that I'm interested in, one of which comes in a smaller sample size. The other two do not have a smaller size ordering option. I was wondering if it would be possible to get these other antibodies in a smaller size as well, so we can test reactivity with Drosophila lamins before ordering the full-sized product?

    A:

    We have a wide range of antibodies to human Lamin. Unfortunately none of these has yet been tested against Drosophila samples, however you may be interested in our Innovator's Reward Program. This allows you to try our primary antibodies in an untested species or application, without the financial risk of failure. To participate you simply complete an online review with an image, detailing the positive or negative results of your study, and in return you receive a discount voucher for 100% of the purchase price of the reviewed product. We are unable to offer free samples of our antibodies but, as you rightly point out, some are available as smaller, sample size aliquots. If a sample size is not listed for a product I am afraid we are unable to offer a smaller aliquot than those already listed.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...