Lamin B1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-48966

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunocytochemistry/ Immunofluorescence, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: RTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Lamin B1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP2-48966]

Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP2-48966]

Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP2-48966] - Analysis in human lymph node and skeletal muscle tissue. Corresponding RNA-seq data are presented for the same tissues.
Western Blot: Lamin B1 Antibody [NBP2-48966]

Western Blot: Lamin B1 Antibody [NBP2-48966]

Western Blot: Lamin B1 Antibody [NBP2-48966] - Analysis in human cell line RH-30.
Immunocytochemistry/ Immunofluorescence: Lamin B1 Antibody [NBP2-48966]

Immunocytochemistry/ Immunofluorescence: Lamin B1 Antibody [NBP2-48966]

Immunocytochemistry/Immunofluorescence: Lamin B1 Antibody [NBP2-48966] - Staining of human cell line MCF7 shows localization to nuclear membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP2-48966]

Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP2-48966]

Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP2-48966] - Staining of human skeletal muscle shows moderate to strong positivity in nuclear membrane in myocytes.
Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP2-48966]

Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP2-48966]

Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP2-48966] - Staining of human lymph node shows moderate to strong positivity in nuclear membrane in non-germinal center cells.
Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP2-48966]

Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP2-48966]

Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP2-48966] - Staining of human skin shows moderate to strong positivity in nuclear membrane in keratinocytes.
Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP2-48966]

Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP2-48966]

Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP2-48966] - Staining of human small intestine shows moderate to strong positivity in nuclear membrane in glandular cells.

Applications for Lamin B1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Lamin B1

Nuclear lamins form a network of intermediate-type filaments at the nucleoplasmic site of the nuclear membrane.Two main subtypes of nuclear lamins can be distinguished, i.e. A-type lamins and B-type lamins. The A-type lamins comprise a set of three proteins arising from the same gene by alternative splicing, i.e. lamin A, lamin C and lamin Adel 10, while the B-type lamins include two proteins arising from two distinct genes, i.e. lamin B1 and lamin B2.

Alternate Names

ADLD, LMN2, LMNB1

Gene Symbol

LMNB1

Additional Lamin B1 Products

Product Documents for Lamin B1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Lamin B1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for Lamin B1 Antibody - BSA Free

Customer Reviews for Lamin B1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Lamin B1 Antibody - BSA Free and earn rewards!

Have you used Lamin B1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Lamin B1 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: I'm looking for human lamin antibodies that might cross react with Drosophila lamins. I've found a few that I'm interested in, one of which comes in a smaller sample size. The other two do not have a smaller size ordering option. I was wondering if it would be possible to get these other antibodies in a smaller size as well, so we can test reactivity with Drosophila lamins before ordering the full-sized product?

    A:

    We have a wide range of antibodies to human Lamin. Unfortunately none of these has yet been tested against Drosophila samples, however you may be interested in our Innovator's Reward Program. This allows you to try our primary antibodies in an untested species or application, without the financial risk of failure. To participate you simply complete an online review with an image, detailing the positive or negative results of your study, and in return you receive a discount voucher for 100% of the purchase price of the reviewed product. We are unable to offer free samples of our antibodies but, as you rightly point out, some are available as smaller, sample size aliquots. If a sample size is not listed for a product I am afraid we are unable to offer a smaller aliquot than those already listed.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...