Latent TGF-beta bp1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79806

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the C terminal of human LTBP1The immunogen for this antibody is LTBP1. Peptide sequence NVCANGDCSNLEGSYMCSCHKGYTRTPDHKHCRDIDECQQGNLCVNGQCK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

154 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Latent TGF-beta bp1 Antibody - BSA Free

Western Blot: Latent TGF-beta bp1 Antibody [NBP1-79806]

Western Blot: Latent TGF-beta bp1 Antibody [NBP1-79806]

Western Blot: LTBP1 Antibody [NBP1-79806] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Applications for Latent TGF-beta bp1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Latent TGF-beta bp1

LTBP1, also known as latent-transforming growth factor beta-binding protein 1, consists of five isoforms of sizes 186.8 kDa, 152.9 kDa, 147.2 kDa, 186.9 kDa, and 153 kDa and is involved in directing and regulating the activity of TGFB1. Current research is being conducted on diseases and disorders such as cataracts, fibrosis, geleophysic dysplasia, macular degeneration, aortic aneurysm, malignant glioma, hepatitis, vaginitis, scleroderma, and nephropathy. The protein is involved in extracellular matrix organization, mitochondrial apoptosis, TGF-beta signaling, and GSK3 signaling pathways, where it interacts with FN1, FBN2, TGFB1, ITGB5, and ATN1.

Alternate Names

Latent TGFbeta bp1, LTBP1

Gene Symbol

LTBP1

Additional Latent TGF-beta bp1 Products

Product Documents for Latent TGF-beta bp1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Latent TGF-beta bp1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Latent TGF-beta bp1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Latent TGF-beta bp1 Antibody - BSA Free and earn rewards!

Have you used Latent TGF-beta bp1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...