LATS2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14184

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: HLLLRSKSEQYDLDSLCAGMEQSLRAGPNEPEGGDKSRKSAKGDKGGKDKKQIQTSPVPVRKNSRDEEKR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for LATS2 Antibody - BSA Free

LATS2 Antibody - BSA Free Immunohistochemistry: LATS2 Antibody - BSA Free [NBP2-14184]

Immunohistochemistry: LATS2 Antibody - BSA Free [NBP2-14184]

Staining of human kidney shows weak to moderate nuclear and cytoplasmic positivity in cells in tubules.
LATS2 Antibody - BSA Free Immunohistochemistry: LATS2 Antibody - BSA Free [NBP2-14184]

Immunohistochemistry: LATS2 Antibody - BSA Free [NBP2-14184]

Staining of human placenta shows weak to moderate nuclear and cytoplasmic positivity in trophoblastic cells.
LATS2 Antibody - BSA Free Immunohistochemistry: LATS2 Antibody - BSA Free [NBP2-14184]

Immunohistochemistry: LATS2 Antibody - BSA Free [NBP2-14184]

Staining of human skeletal muscle shows weak to moderate nuclear and cytoplasmic positivity in myocytes.
LATS2 Antibody - BSA Free Immunohistochemistry: LATS2 Antibody - BSA Free [NBP2-14184]

Immunohistochemistry: LATS2 Antibody - BSA Free [NBP2-14184]

Staining of human testis shows weak to moderate nuclear and cytoplasmic positivity in cells in seminiferous ducts.

Applications for LATS2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LATS2

LATS2 encodes a serine/threonine protein kinase belonging to the LATS tumor suppressor family. The protein localizes to centrosomes during interphase, and early and late metaphase. It interacts with the centrosomal proteins aurora-A and ajuba and is required for accumulation of gamma-tubulin and spindle formation at the onset of mitosis. It also interacts with a negative regulator of p53 and may function in a positive feedback loop with p53 that responds to cytoskeleton damage. Additionally, it can function as a co-repressor of androgen-responsive gene expression.

Alternate Names

EC 2.7.11, EC 2.7.11.1, FLJ13161, Kinase phosphorylated during mitosis protein, KPM, Large tumor suppressor homolog 2, LATS (large tumor suppressor, Drosophila) homolog 2, LATS, large tumor suppressor, homolog 2 (Drosophila), serine/threonine kinase KPM, Serine/threonine-protein kinase kpm, serine/threonine-protein kinase LATS2, Warts-like kinase

Gene Symbol

LATS2

Additional LATS2 Products

Product Documents for LATS2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for LATS2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LATS2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LATS2 Antibody - BSA Free and earn rewards!

Have you used LATS2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...