LCMT1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14188

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: RLLSNGWETASAVDMMELYNRLPRAEVSRIESLEFLDEMELLEQLMRHYCLCWATKGGNELGLKE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for LCMT1 Antibody - BSA Free

Western Blot: LCMT1 Antibody [NBP2-14188]

Western Blot: LCMT1 Antibody [NBP2-14188]

Western Blot: LCMT1 Antibody [NBP2-14188] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: LCMT1 Antibody [NBP2-14188]

Immunohistochemistry-Paraffin: LCMT1 Antibody [NBP2-14188]

Immunohistochemistry-Paraffin: LCMT1 Antibody [NBP2-14188] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Western Blot: LCMT1 Antibody [NBP2-14188]

Western Blot: LCMT1 Antibody [NBP2-14188]

Western Blot: LCMT1 Antibody [NBP2-14188] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: LCMT1 Antibody [NBP2-14188]

Immunohistochemistry-Paraffin: LCMT1 Antibody [NBP2-14188]

Immunohistochemistry-Paraffin: LCMT1 Antibody [NBP2-14188] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: LCMT1 Antibody [NBP2-14188]

Immunohistochemistry-Paraffin: LCMT1 Antibody [NBP2-14188]

Immunohistochemistry-Paraffin: LCMT1 Antibody [NBP2-14188] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: LCMT1 Antibody [NBP2-14188]

Immunohistochemistry-Paraffin: LCMT1 Antibody [NBP2-14188]

Immunohistochemistry-Paraffin: LCMT1 Antibody [NBP2-14188] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
LCMT1 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: LCMT1 Antibody [NBP2-14188]

Immunocytochemistry/ Immunofluorescence: LCMT1 Antibody [NBP2-14188]

Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.

Applications for LCMT1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LCMT1

LCMT1 catalyzes the methylation of the carboxyl group of the C-terminal leucine residue (leu309) of the catalytic subunit of protein phosphatase-2A (PPP2CA; MIM 176915) (De Baere et al., 1999 [PubMed 10600115]).[supplied by OMIM]

Alternate Names

CGI-68, EC 2.1.1.-, LCMT, leucine carboxyl methyltransferase 1, PPMT1, protein phosphatase methyltransferase 1, Protein-leucine O-methyltransferase

Gene Symbol

LCMT1

Additional LCMT1 Products

Product Documents for LCMT1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for LCMT1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LCMT1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LCMT1 Antibody - BSA Free and earn rewards!

Have you used LCMT1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...