LIN-28B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85438

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KKCHYCQSIMHMVANCPHKNVAQPPASSQGRQEAESQPCTSTLPREVGGGHGCTSPPFPQ

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (87%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for LIN-28B Antibody - BSA Free

Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP1-85438]

Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP1-85438]

Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP1-85438] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP1-85438]

Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP1-85438]

Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP1-85438] - Staining of human placenta shows high expression.
Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP1-85438]

Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP1-85438]

Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP1-85438] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP1-85438]

Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP1-85438]

Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP1-85438] - Staining of human kidney, liver, placenta and testis using Anti-LIN28B antibody NBP1-85438 (A) shows similar protein distribution across tissues to independent antibody NBP2-32352 (B).
Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP1-85438]

Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP1-85438]

Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP1-85438] - Staining of human liver.
Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP1-85438]

Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP1-85438]

Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP1-85438] - Staining of human testis.
Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP1-85438]

Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP1-85438]

Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP1-85438] - Staining of human kidney.
Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP1-85438]

Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP1-85438]

Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP1-85438] - Analysis in human placenta and prostate tissues. Corresponding LIN-28B RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP1-85438]

Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP1-85438]

Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP1-85438] - Staining of human kidney, liver, placenta and prostate using Anti-LIN-28B antibody NBP1-85438 (A) shows similar protein distribution across tissues to independent antibody NBP2-32352 (B).
Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP1-85438]

Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP1-85438]

Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP1-85438] - Staining of human kidney shows no positivity in cells in tubules as expected.

Applications for LIN-28B Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LIN-28B

Lin28B acts as a suppressor of microRNA (miRNA) biogenesis by specifically binding the precursor let-7 (pre-let-7),a miRNA precursor. Acts by binding pre-let-7 and recruiting ZCCHC11/TUT4 uridylyltransferase, leading to the terminaluridylation of pre-let-7. Urid

Long Name

LIN-28 Homolog B

Alternate Names

CSDD2, Lin-28.2, LIN28B

Gene Symbol

LIN28B

Additional LIN-28B Products

Product Documents for LIN-28B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for LIN-28B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for LIN-28B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LIN-28B Antibody - BSA Free and earn rewards!

Have you used LIN-28B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...