Lipase A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-47397

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: FALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Lipase A Antibody - BSA Free

Immunohistochemistry-Paraffin: Lipase A Antibody [NBP2-47397]

Immunohistochemistry-Paraffin: Lipase A Antibody [NBP2-47397]

Immunohistochemistry-Paraffin: Lipase A Antibody [NBP2-47397] - Analysis in human spleen and skeletal muscle tissues. Corresponding Lipase A RNA-seq data are presented for the same tissues.
Western Blot: Lipase A Antibody [NBP2-47397]

Western Blot: Lipase A Antibody [NBP2-47397]

Western Blot: Lipase A Antibody [NBP2-47397] - Analysis in human spleen tissue.
Immunocytochemistry/ Immunofluorescence: Lipase A Antibody [NBP2-47397]

Immunocytochemistry/ Immunofluorescence: Lipase A Antibody [NBP2-47397]

Immunocytochemistry/Immunofluorescence: Lipase A Antibody [NBP2-47397] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Lipase A Antibody [NBP2-47397]

Immunohistochemistry-Paraffin: Lipase A Antibody [NBP2-47397]

Immunohistochemistry-Paraffin: Lipase A Antibody [NBP2-47397] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Lipase A Antibody [NBP2-47397]

Immunohistochemistry-Paraffin: Lipase A Antibody [NBP2-47397]

Immunohistochemistry-Paraffin: Lipase A Antibody [NBP2-47397] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Lipase A Antibody [NBP2-47397]

Immunohistochemistry-Paraffin: Lipase A Antibody [NBP2-47397]

Immunohistochemistry-Paraffin: Lipase A Antibody [NBP2-47397] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: Lipase A Antibody [NBP2-47397]

Immunohistochemistry-Paraffin: Lipase A Antibody [NBP2-47397]

Immunohistochemistry-Paraffin: Lipase A Antibody [NBP2-47397] - Staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.
Immunohistochemistry-Paraffin: Lipase A Antibody [NBP2-47397]

Immunohistochemistry-Paraffin: Lipase A Antibody [NBP2-47397]

Immunohistochemistry-Paraffin: Lipase A Antibody [NBP2-47397] - Staining of human lymphoid tissues shows strong cytoplasmic positivity in a subset of non-germinal center cells.

Applications for Lipase A Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LIPA

Lipase A, also known as LIPA or Lysosomal acid lipase/cholesteryl ester hydrolase, has a 399 amino acid long isoform that is 45 kDa and a short 343 amino acid isoform that is 39 kDa; lysosome located; is very important for the intracellular hydrolysis of cholesteryl esters and triglycerides that have been internalized via receptor-mediated endocytosis of lipoprotein particles, and also in mediating the effect of LDL (low density lipoprotein) uptake on suppression of hydroxymethylglutaryl-CoA reductase and activation of endogenous cellular cholesteryl ester formation. This protein is currently being studied for involvement in the following diseases and disorders: cholesteryl ester storage disease, wolman disease, cholesterol, cholesterol ester storage disease, lysosomal storage disease, coronary heart disease, hepatitis c, splenomegaly, hepatitis b, hepatitis, hyperlipidemia, hypercholesterolemia, tuberculosis, obesity atherosclerosis, alzheimer's disease, neisseria meningitides, lipid storage disease, lipodystrophy, pandas, wolman disease, and blepharitis. The LIPA protein has been shown to interact with HIST1H4A, HIST1H4B, HIST1H4C, SOAT1, and HIST1H4E in cholesterol and sphingolipids transport / distribution to the intracellular membrane compartments (normal and CF), steroid biosynthesis, and lysosome pathways.

Long Name

Lipase A

Alternate Names

CESD, Lipase A

Gene Symbol

LIPA

Additional LIPA Products

Product Documents for Lipase A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Lipase A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Lipase A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Lipase A Antibody - BSA Free and earn rewards!

Have you used Lipase A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...