LONP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-81734

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human, Mouse, Insect - Drosophila

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western, Knockdown Validated

Cited:

Western Blot, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSNENLDLARAQAVLEEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFYGP

Reactivity Notes

Drosophila reactivity reported in scientific literature (PMID: 29467464).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for LONP1 Antibody - BSA Free

Western Blot: LONP1 Antibody [NBP1-81734]

Western Blot: LONP1 Antibody [NBP1-81734]

Western Blot: LONP1 Antibody [NBP1-81734] - Analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-LONP1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Simple Western: LONP1 Antibody [NBP1-81734]

Simple Western: LONP1 Antibody [NBP1-81734]

Simple Western: LONP1 Antibody [NBP1-81734] - Simple Western lane view shows a specific band for LONP1 in 0.2 mg/ml of h. Kidney (left), NIH-3T3 (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734]

Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734]

Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human duodenum shows granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734]

Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734]

Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human fallopian tube shows granular cytoplasmic positivity in glandular cells.
Western Blot: LONP1 Antibody [NBP1-81734]

Western Blot: LONP1 Antibody [NBP1-81734]

LONP1-Antibody-Western-Blot-NBP1-81734-img0023.jpg
Immunocytochemistry/ Immunofluorescence: LONP1 Antibody [NBP1-81734]

Immunocytochemistry/ Immunofluorescence: LONP1 Antibody [NBP1-81734]

Immunocytochemistry/Immunofluorescence: LONP1 Antibody [NBP1-81734] - Staining of human cell line U-251 MG shows localization to nucleoplasm & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734]

Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734]

Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human tonsil shows granular cytoplasmic positivity.
Western Blot: LONP1 Antibody [NBP1-81734]

Western Blot: LONP1 Antibody [NBP1-81734]

Western Blot: LONP1 Antibody [NBP1-81734] - Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734]

Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734]

Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human pancreas shows granular cytoplasmic positivity.
Simple Western: LONP1 Antibody [NBP1-81734]

Simple Western: LONP1 Antibody [NBP1-81734]

Simple Western: LONP1 Antibody [NBP1-81734] - Electropherogram image(s) of corresponding Simple Western lane view. LONP1 antibody was used at 1:20 dilution on h. Kidney and NIH-3T3 lysate(s).
LONP1 Antibody

Western Blot: LONP1 Antibody [NBP1-81734] -

nbp1-81734_rabbit-polyclonal-lonp1-antibody-2092023181153.jpg
LONP1 Antibody

Western Blot: LONP1 Antibody [NBP1-81734] -

Western Blot: LONP1 Antibody [NBP1-81734] - Altered mitochondrial features in cybrid cells carrying MELAS, MERRF, m.5514 A > G (mt-tRNATrp), m.1643A > G (mt-tRNAVal), & m.14487 T > C (ND6) mutations. (A) Representative western blot of LONP1, AFG3L2 & CLPP peptidases in mutant & wild type (WT) cybrid cells. The membrane was also probed with porin as a loading control. Full-length western blots & lower-exposure blots of porin are included in supplementary information. (B) Densitometric analysis of LONP1, AFG3L2 & CLPP normalized to porin & represented as fold change relative to WT (top). Quantitative data are from at least three independent experiments. Results from this analysis are also shown as a heatmap (bottom). The color & the corresponding value in log2 scale are depicted on the left. (C) Representative Blue Native-PAGE of OXPHOS complexes in mutant & WT cybrid cells. Full-length blots & lower-exposure blots for those with high contrast are included in supplementary information. (D) Densitometric analysis of OXPHOS complexes normalized to complex-II (loading control) & represented as fold change relative to WT. (E) Cellular ATP determination in mutant & WT cybrid cells. (F & G) Determination of Ca2+ (F) & ROS (G) by flow cytometry in mutant & WT cybrid cells with Fluo-3 & MitoSOX Red, respectively. All data are the mean ± SEM of at least three different experiments. Differences from WT values were found to be statistically significant at *p < 0.05, **p < 0.01 & ***p < 0.001. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/28740091), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for LONP1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Simple Western

1:20

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended.
See Simple Western Antibody Database for Simple Western validation: Tested in Human Kidney, NIH-3T3, separated by Size, antibody dilution of 1:20, apparent MW was 110, 107 kDa

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LONP1

LONP1 encodes a mitochondrial matrix protein in the Lon family of ATP-dependent proteases. A similar E. coli protein regulates gene expression by targeting specific regulatory proteins for degradation. This protein binds a specific sequence in the light and heavy chain promoters of the mitochondrial genome which are involved in regulation of DNA replication and transcription. [provided by RefSeq]

Alternate Names

EC 3.4.21, EC 3.4.21.-, EC 3.4.21.53, hLON, hLON ATP-dependent protease, LON, lon peptidase 1, mitochondrial, lon protease homolog, mitochondrial, Lon protease-like protein, LonHS, LONP, Mitochondrial ATP-dependent protease Lon, mitochondrial lon peptidase 1, mitochondrial lon protease-like protein, PIM1, protease, serine, 15, PRSS15MGC1498, Serine protease 15

Gene Symbol

LONP1

Additional LONP1 Products

Product Documents for LONP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for LONP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for LONP1 Antibody - BSA Free

Customer Reviews for LONP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LONP1 Antibody - BSA Free and earn rewards!

Have you used LONP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...