LRP-1B Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-49582
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Predicted:
Mouse (95%). Backed by our 100% Guarantee.
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GGPSAFKLPHTAPPIYLNSDLKGPLTAGPTNYSNPVYAKLYMDGQNCRNSLGSVDERKELLPKK
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for LRP-1B Antibody - BSA Free
Immunohistochemistry-Paraffin: LRP-1B Antibody [NBP2-49582]
Immunohistochemistry-Paraffin: LRP-1B Antibody [NBP2-49582] - Staining of human kidney shows no positivity in cells in tubules as expected.Immunohistochemistry-Paraffin: LRP-1B Antibody [NBP2-49582]
Immunohistochemistry-Paraffin: LRP-1B Antibody [NBP2-49582] - Staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.Immunohistochemistry-Paraffin: LRP-1B Antibody [NBP2-49582]
Immunohistochemistry-Paraffin: LRP-1B Antibody [NBP2-49582] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.Immunohistochemistry-Paraffin: LRP-1B Antibody [NBP2-49582]
Immunohistochemistry-Paraffin: LRP-1B Antibody [NBP2-49582] - Staining of human cervix, uterine, shows no postivity in epithelial cells as expected.Immunohistochemistry: LRP-1B Antibody - BSA Free [NBP2-49582] -
The results of immunohistochemistry. (a) Representative illustrations of the expression of RNF213, KMT2D, CSMD3 and LRP1B in lung cancer and benign disease. “−" and “+" represent low expression of RNF213, KMT2D, CSMD3 and LRP1B (IHC, ×200). “++" and “+++" represent high expression of these four genes (IHC, ×200). (b) The summary of RNF213, KMT2D, CSMD3 and LRP1B expression in 27 lung cancer and 14 benign disease tissues. () +++, () ++, () +, () − Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/33200540), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for LRP-1B Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: LRP-1B
Long Name
LDL Receptor-related Protein 1B
Alternate Names
LRP-DIT, LRP1B
Gene Symbol
LRP1B
Additional LRP-1B Products
Product Documents for LRP-1B Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for LRP-1B Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for LRP-1B Antibody - BSA Free
Customer Reviews for LRP-1B Antibody - BSA Free
There are currently no reviews for this product. Be the first to review LRP-1B Antibody - BSA Free and earn rewards!
Have you used LRP-1B Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...