Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody - Azide and BSA Free
Novus Biologicals | Catalog # NBP2-92982
Loading...
Key Product Details
Species Reactivity
Human, Mouse
Applications
Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 90-190 of mouse Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 (NP_001017426.1). LESLHGCVQALLREPAQPGLWEQLGQLYESEHDSEEAVCCYHRALRYGGSFAELGPRIGRLQQAQLWNFHAGSCQHRAKVLPPLEQVWNLLHLEHKRNYGA
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
176 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images
Western Blot: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 AntibodyAzide and BSA Free [NBP2-92982]
Western Blot: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody [NBP2-92982] - Analysis of extracts of mouse brain, using Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBSTImmunocytochemistry/ Immunofluorescence: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody - Azide and BSA Free [NBP2-92982]
Immunocytochemistry/Immunofluorescence: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody [NBP2-92982] - Analysis of U2OS cells using Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 at dilution of 1:100. Blue: DAPI for nuclear staining.Western Blot: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 AntibodyAzide and BSA Free [NBP2-92982]
Western Blot: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody [NBP2-92982] - Analysis of extracts of various cell lines, using Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3.Exposure time: 90s.Immunocytochemistry/ Immunofluorescence: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody - Azide and BSA Free [NBP2-92982]
Immunocytochemistry/Immunofluorescence: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody [NBP2-92982] - Analysis of NIH/3T3 cells using Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 at dilution of 1:100. Blue: DAPI for nuclear staining.Applications
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50-1:200
Western Blot
1:500-1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
Azide and BSA Free
Preservative
0.05% Proclin 300
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Lysine (K)-specific Demethylase 6B/KDM6B
JMJD3 antibodies are useful tools for epigenetics research and specifically for histone modification studies.
Alternate Names
JMJD3, KDM6B, Lysine (K)specific Demethylase 6B
Gene Symbol
KDM6B
Additional Lysine (K)-specific Demethylase 6B/KDM6B Products
Product Documents
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.govRelated Research Areas
Customer Reviews
There are currently no reviews for this product. Be the first to review Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody - Azide and BSA Free and earn rewards!
Have you used Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...