MANF Antibody (1D10) - Azide and BSA Free

Novus Biologicals | Catalog # H00007873-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 1D10

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

ARMET (NP_006001.2, 116 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGETCKGCAEKSDYIRKINELMPKYAPKAASARTDL

Specificity

Reacts with arginine-rich, mutated in early stage tumors.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for MANF Antibody (1D10) - Azide and BSA Free

Western Blot: MANF Antibody (1D10) [H00007873-M01]

Western Blot: MANF Antibody (1D10) [H00007873-M01]

Western Blot: MANF Antibody (1D10) [H00007873-M01] - Western Blot detection against Immunogen (33.33 KDa).
Immunocytochemistry/ Immunofluorescence: MANF Antibody (1D10) [H00007873-M01]

Immunocytochemistry/ Immunofluorescence: MANF Antibody (1D10) [H00007873-M01]

Immunocytochemistry/Immunofluorescence: MANF Antibody (1D10) [H00007873-M01] - Analysis of monclonal antibody to MANF antibody on HeLa cell. Image from verified customer review.
Immunocytochemistry/ Immunofluorescence: MANF Antibody (1D10) [H00007873-M01]

Immunocytochemistry/ Immunofluorescence: MANF Antibody (1D10) [H00007873-M01]

Immunocytochemistry/Immunofluorescence: MANF Antibody (1D10) [H00007873-M01] - Analysis of monoclonal antibody to MANF on HeLa cell. Antibody concentration 40 ug/ml.
Sandwich ELISA: MANF Antibody (1D10) [H00007873-M01] - Detection limit for recombinant GST tagged MANF is 0.03 ng/ml as a capture antibody.

Applications for MANF Antibody (1D10) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.

Reviewed Applications

Read 1 review rated 5 using H00007873-M01 in the following applications:

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: MANF

The protein encoded by this gene is localized in the endoplasmic reticulum (ER) and golgi, and is also secreted. Reducing expression of this gene increases susceptibility to ER stress-induced death and promotes cell proliferation. The protein was initially thought to be longer at the N-terminus and to contain an arginine-rich region but transcribed evidence indicates a smaller open reading frame that does not encode the arginine tract. The presence of a specific mutation changing the previously numbered codon 50 from ATG to AGG, or deletion of that codon, has been reported in a variety of solid tumors. With the protein size correction, this codon is now identified as the initiation codon. [provided by RefSeq]

Long Name

Mesencephalic Astrocyte-derived Neurotrphic Factor

Alternate Names

ARMET, ARP

Entrez Gene IDs

7873 (Human)

Gene Symbol

MANF

Additional MANF Products

Product Documents for MANF Antibody (1D10) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MANF Antibody (1D10) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for MANF Antibody (1D10) - Azide and BSA Free

Customer Reviews for MANF Antibody (1D10) - Azide and BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used MANF Antibody (1D10) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 1 of 1 review Showing All
Filter By:
  • MANF Antibody (1D10)
    Name: Anonymous
    Application: Immunocytochemistry
    Sample Tested: HeLa cells
    Species: Human
    Verified Customer | Posted 01/03/2022
    HeLa cells
    MANF Antibody (1D10) - Azide and BSA Free H00007873-M01

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...