Map17 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84290

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QEEPEPAHMILTVGNKADGVLVGTDGRYSSMAASFRSSEHENAYENVPEEEGKVRST

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Map17 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Map17 Antibody [NBP1-84290]

Immunocytochemistry/ Immunofluorescence: Map17 Antibody [NBP1-84290]

Immunocytochemistry/Immunofluorescence: Map17 Antibody [NBP1-84290] - Staining of human cell line RPTEC TERT1 shows localization to nuclear speckles & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Map17 Antibody [NBP1-84290]

Immunohistochemistry-Paraffin: Map17 Antibody [NBP1-84290]

Immunohistochemistry-Paraffin: Map17 Antibody [NBP1-84290] - Staining of human skin shows weak membranous and cytoplasmic positivity in superficial layer of squamous epithelial cells.
Immunohistochemistry-Paraffin: Map17 Antibody [NBP1-84290]

Immunohistochemistry-Paraffin: Map17 Antibody [NBP1-84290]

Immunohistochemistry-Paraffin: Map17 Antibody [NBP1-84290] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Map17 Antibody [NBP1-84290]

Immunohistochemistry-Paraffin: Map17 Antibody [NBP1-84290]

Immunohistochemistry-Paraffin: Map17 Antibody [NBP1-84290] - Staining of human kidney shows strong positivity in apical membrane in cells in tubules.
Immunohistochemistry-Paraffin: Map17 Antibody [NBP1-84290]

Immunohistochemistry-Paraffin: Map17 Antibody [NBP1-84290]

Immunohistochemistry-Paraffin: Map17 Antibody [NBP1-84290] - Staining of human lymphoid tissues shows moderate cytoplasmic positivity in non-germinal center cells.
Map17 Antibody - BSA Free Western Blot: Map17 Antibody - BSA Free [NBP1-84290]

Western Blot: Map17 Antibody - BSA Free [NBP1-84290]

Analysis in control (vector only transfected HEK293T lysate) and PDZK1IP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY417088).
Map17 Antibody - BSA Free Immunohistochemistry-Paraffin: Map17 Antibody - BSA Free [NBP1-84290]

Immunohistochemistry-Paraffin: Map17 Antibody - BSA Free [NBP1-84290]

Analysis in human kidney and endometrium tissues using HPA014907 antibody. Corresponding PDZK1IP1 RNA-seq data are presented for the same tissues.

Applications for Map17 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200-1:500

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Map17

Map17, also known as small PDZK1-associated protein (SPAP) is an endogenous regulator of cellular PDZK1 levels through the regulation of PDZK1 turnover. MAP17 is only expressed at significant levels in the proximal tubular epithelial cells of the kidney, and is diffusely expressed in various carcinomas originating from kidney, colon, lung and breast. MAP17 is thought to be associates with tumor formation, and MAP17 antibodies are useful for cancer research and protein turnover studies.

Alternate Names

17 kDa membrane-associated protein, DD96, MAP17epithelial protein up-regulated in carcinoma, membrane associated protein 17, membrane-associated protein 17, PDZK1 interacting protein 1, PDZK1-interacting protein 1, Protein DD96, RP1-18D14.5, SPAP

Gene Symbol

PDZK1IP1

Additional Map17 Products

Product Documents for Map17 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Map17 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Map17 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Map17 Antibody - BSA Free and earn rewards!

Have you used Map17 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...