MBP Antibody (7D2) [CoraFluor™ 1]

Novus Biologicals | Catalog # NBP1-05204CL1

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat, Porcine, Bovine, Equine

Applications

Immunohistochemistry, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

CoraFluor 1

Antibody Source

Monoclonal Mouse IgG1 Clone # 7D2
Loading...

Product Specifications

Immunogen

Purified myelin basic protein isolated from bovine brain, epitope maps to the peptide AEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLG, amino acids 145-184 of the human 21.5kDa sequence.

Marker

Oligodendrocyte Marker, Myelin Marker

Specificity

The MBP Antibody (7D2) antibody binds only the 21.5kDa and 18.5kDa rat MBP isotypes, but all four isotypes of human and bovine MBP.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1

Description

This conjugate is made on demand and is not held in inventory. Each order represents a unique lot. All conjugates are generated using validated conjugation protocols and meet strict degree of labeling (F/P) specifications; additional information is available upon request. The antibody concentration is provided on the individual product label.

For specialized conjugation needs, like large quantities, specific concentrations, and defined F/P ratios, bulk and custom antibody conjugation services are available.

Scientific Data Images for MBP Antibody (7D2) [CoraFluor™ 1]

MBP Antibody (7D2) [CoraFluor™ 1]

Product Feature: CoraFluor Probes for TR-FRET

CoraFluor™ 1, amine reactive (Catalog:7920) and CoraFluor™ 2, amine reactive (Catalog # 7950) are terbium-based probes that have been developed for use as TR-FRET donors. They emit wavelengths compatible with commonly used fluorescent acceptor dyes such as BODIPY® (or BDY) and Janelia Fluor® dyes, FITC (Catalog # 5440), TMR and Cyanine 5 (Catalog # 5436). CoraFluor™ fluorescence is brighter and more stable in biological media than existing TR-FRET donors, leading to enhanced sensitivity and improved data generation. CoraFluor™ 1 exhibits excitation upon exposure to a 337 nm UV laser.

Applications for MBP Antibody (7D2) [CoraFluor™ 1]

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Recommended applications are based on validated applications from the unconjugated base product NBP1-05204. This conjugated antibody is not kept in inventory and is made to order using validated conjugation protocols.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS

Preservative

No Preservative

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark. Do not freeze.

Background: MBP

Myelin Basic Protein (MBP) functions in the nervous system in myelination and is expressed in oligodendrocytes following differentiation. There are numerous isoforms generated by differential splicing events and post-translational modifications that have specialized functions. These functions include participation in signaling pathways prior to myelination, myelination or the re-myelination process following neural injury.

Long Name

Myelin Basic Protein

Alternate Names

Hmbpr, mld, shi

Gene Symbol

MBP

Additional MBP Products

Product Documents for MBP Antibody (7D2) [CoraFluor™ 1]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MBP Antibody (7D2) [CoraFluor™ 1]

Sold for research purposes only under agreement from Massachusetts General Hospital, US Patent No. 12,134,721. A license is required for development of new commercial assay platforms (e.g., microarrays, microfluidics), diagnostic use or other unlicensed uses. Please contact Technical Support for further details: techsupport@bio-techne.com.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for MBP Antibody (7D2) [CoraFluor™ 1]

There are currently no reviews for this product. Be the first to review MBP Antibody (7D2) [CoraFluor™ 1] and earn rewards!

Have you used MBP Antibody (7D2) [CoraFluor™ 1]?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...