MCM6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58075

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to MCM6(minichromosome maintenance complex component 6) The peptide sequence was selected from the C terminal of MCM6. Peptide sequence RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MCM6 Antibody - BSA Free

Western Blot: MCM6 Antibody [NBP1-58075]

Western Blot: MCM6 Antibody [NBP1-58075]

Western Blot: MCM6 Antibody [NBP1-58075] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry-Paraffin: MCM6 Antibody [NBP1-58075]

Immunohistochemistry-Paraffin: MCM6 Antibody [NBP1-58075]

Immunohistochemistry-Paraffin: MCM6 Antibody [NBP1-58075] - Human thymus.
Immunohistochemistry-Paraffin: MCM6 Antibody [NBP1-58075]

Immunohistochemistry-Paraffin: MCM6 Antibody [NBP1-58075]

Immunohistochemistry-Paraffin: MCM6 Antibody [NBP1-58075] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.

Applications for MCM6 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MCM6

The protein encoded by the MCM6 gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of the complex by CDC2 kinase reduces the helicase activity, suggesting a role in the regulation of DNA replication.The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of the complex by CDC2 kinase reduces the helicase activity, suggesting a role in the regulation of DNA replication.

Alternate Names

DNA replication licensing factor MCM6, EC 3.6.4.12, MCG40308, MCM6 minichromosome maintenance deficient 6 (MIS5 homolog, S. pombe), MCM6 minichromosome maintenance deficient 6 (MIS5 homolog, S. pombe) (S.cerevisiae), minichromosome maintenance complex component 6, minichromosome maintenance deficient (mis5, S. pombe) 6, minichromosome maintenance deficient 6 homolog, minichromosome maintenance deficient 6 homolog (S. cerevisiae), Mis5, MIS5 homolog, p105MCM

Gene Symbol

MCM6

UniProt

Additional MCM6 Products

Product Documents for MCM6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MCM6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MCM6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MCM6 Antibody - BSA Free and earn rewards!

Have you used MCM6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...