MED15 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-37851

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen for Anti-MED15 antibody is: synthetic peptide directed towards the C-terminal region of Human MED15.. Peptide sequence: TPQSMPPPPQPSPQPGQPSSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

86 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MED15 Antibody - BSA Free

Western Blot: MED15 Antibody [NBP2-37851]

Western Blot: MED15 Antibody [NBP2-37851]

Western Blot: MED15 Antibody [NBP2-37851] - Host: Rabbit. Target Name: MED15. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml
Western Blot: MED15 Antibody [NBP2-37851]

Western Blot: MED15 Antibody [NBP2-37851]

Western Blot: MED15 Antibody [NBP2-37851] - Fetal Liver lysates, Antibody Dilution: 1.0 ug/ml.
Western Blot: MED15 Antibody [NBP2-37851]

Western Blot: MED15 Antibody [NBP2-37851]

Western Blot: MED15 Antibody [NBP2-37851] - Host: Rabbit. Target Name: MED15. Sample Tissue: Human ACHN Whole Cell. Antibody Dilution: 1ug/ml

Applications for MED15 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MED15

MED15 is encoded by this gene is a subunit of the multiprotein complexes PC2 and ARC/DRIP and may function as a transcriptional coactivator in RNA polymerase II transcription. This gene contains stretches of trinucleotide repeats and is located in the chromosome 22 region which is deleted in DiGeorge syndrome. Two transcript variants encoding different isoforms have been found for this gene.

Alternate Names

ARC105Arc105, CAG7A, CTG repeat protein 7a, CTG7A, FLJ42282, FLJ42935, mediator complex subunit 15PC2 glutamine/Q-rich-associated protein, mediator of RNA polymerase II transcription subunit 15, PC2 (positive cofactor 2, multiprotein complex) glutamine/Q-rich-associatedprotein, PC2-glutamine-rich-associated protein, PCQAPDKFZp686A2214, Positive cofactor 2 glutamine/Q-rich-associated protein, positive cofactor 2, glutamine/Q-rich-associated protein, TIG1DKFZp762B1216, TIG-1TPA-inducible gene 1 protein, TNRC7, TPA inducible gene-1, TPA inducible protein, trinucleotide repeat containing 7,105-kD, Trinucleotide repeat-containing gene 7 protein

Gene Symbol

MED15

UniProt

Additional MED15 Products

Product Documents for MED15 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MED15 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MED15 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MED15 Antibody - BSA Free and earn rewards!

Have you used MED15 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...