MED6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10314

Novus Biologicals
Loading...

Key Product Details

Validated by

Biological Validation

Species Reactivity

Human

Applications

Western Blot, Chromatin Immunoprecipitation (ChIP)

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MED6 (NP_005457). Peptide sequence LLLDLRQKFPPKFVQLKPGEKPVPVDQTKKEAEPIPETVKPEEKETTKNV

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MED6 Antibody - BSA Free

Chromatin Immunoprecipitation: MED6 Antibody [NBP3-10314] - Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.

Applications for MED6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MED6

MED6 also known as Mediator of RNA polymerase II transcription subunit 6, is a 246 amino acid protein that is 28 kDa; as a component of the Mediator complex, a co-activator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes, functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery, by direct interactions with regulatory proteins the mediator is recruited to promoters and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Disease research is currently being performed with relation to MED6 and spondylolysis, renal carcinoma, carcinoma, renal cell carcinoma, cholesterol, and neuronitis. This protein has also been shown to have interactions with over 70 proteins including SMAD2, SMAD1, CDK8, MED15, and MED25 in developmental biology, transcriptional regulation of white adipocyte differentiation, generic transcription pathway, gene expression, and transcription ligand-dependent transcription of retinoid-target genes pathways.

Alternate Names

Activator-recruited cofactor 33 kDa component, ARC33, mediator complex subunit 6hMed6, mediator of RNA polymerase II transcription subunit 6, mediator of RNA polymerase II transcription, subunit 6 homolog, mediator of RNA polymerase II transcription, subunit 6 homolog (S. cerevisiae), NY-REN-28, Renal carcinoma antigen NY-REN-28

Gene Symbol

MED6

Additional MED6 Products

Product Documents for MED6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MED6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MED6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MED6 Antibody - BSA Free and earn rewards!

Have you used MED6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...