MEKK1 Antibody (2F6) - IHC-Prediluted
Novus Biologicals | Catalog # NBP2-48208
Key Product Details
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG2a Kappa Clone # 2F6
Format
IHC-Prediluted
Loading...
Product Specifications
Immunogen
Partial recombinant MEKK1 (aa1077-1176) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK) (Uniprot: Q13233)
Localization
Cytoplasmic
Clonality
Monoclonal
Host
Mouse
Isotype
IgG2a Kappa
Description
The prediluted antibody does not require any mixing, dilution, reconstitution, or titration; the antibody is ready-to-use and optimized for staining.
Scientific Data Images for MEKK1 Antibody (2F6) - IHC-Prediluted
Immunohistochemistry-Paraffin: MEKK1 Antibody (2F6) - IHC-Prediluted [NBP2-48208]
Immunohistochemistry-Paraffin: MEKK1 Antibody (2F6) - IHC-Prediluted [NBP2-48208] - Formalin-fixed, paraffin-embedded human Cervical Carcinoma stained with MAP3K1 Mouse Monoclonal Antibody (2F6).Immunohistochemistry-Paraffin: MEKK1 Antibody (2F6) - IHC-Prediluted [NBP2-48208]
Immunohistochemistry-Paraffin: MEKK1 Antibody (2F6) - IHC-Prediluted [NBP2-48208] - Formalin-fixed, paraffin-embedded human Uterine Carcinoma stained with MAP3K1 Mouse Monoclonal Antibody (2F6).Immunohistochemistry-Paraffin: MEKK1 Antibody (2F6) - IHC-Prediluted [NBP2-48208]
Immunohistochemistry-Paraffin: MEKK1 Antibody (2F6) - IHC-Prediluted [NBP2-48208] - Formalin-fixed, paraffin-embedded human Thyroid Carcinoma stained with MAP3K1 Mouse Monoclonal Antibody (2F6).Applications for MEKK1 Antibody (2F6) - IHC-Prediluted
Application
Recommended Usage
Immunohistochemistry
Optimal dilutions of this antibody should be experimentally determined.
Immunohistochemistry-Paraffin
Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Immunohistochemistry (Formalin-fixed): 1-2ug/ml for 30 minutes at RT. Staining of formalin-fixed tissues requires heating tissue sections in 10mM Tris Buffer with 1mM EDTA, pH 9.0, for 45 min at 95C followed by cooling at RT for 20 minutes.
Optimal dilution for a specific application should be determined.
Optimal dilution for a specific application should be determined.
Formulation, Preparation, and Storage
Purification
Protein A or G purified
Formulation
10 mM PBS with 0.05% BSA
Format
IHC-Prediluted
Preservative
0.05% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C.
Background: MEKK1
Alternate Names
Map3k1, MAPK/ERK kinase kinase 1, MAPKKK1MAP/ERK kinase kinase 1, MEK kinase 1, MEKK1EC 2.7.11.25, MEKKMEKK 1, mitogen-activated protein kinase kinase kinase 1
Gene Symbol
MAP3K1
Additional MEKK1 Products
Product Documents for MEKK1 Antibody (2F6) - IHC-Prediluted
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for MEKK1 Antibody (2F6) - IHC-Prediluted
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for MEKK1 Antibody (2F6) - IHC-Prediluted
There are currently no reviews for this product. Be the first to review MEKK1 Antibody (2F6) - IHC-Prediluted and earn rewards!
Have you used MEKK1 Antibody (2F6) - IHC-Prediluted?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...